DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and ARRDC4

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_899232.2 Gene:ARRDC4 / 91947 HGNCID:28087 Length:418 Species:Homo sapiens


Alignment Length:440 Identity:95/440 - (21%)
Similarity:168/440 - (38%) Gaps:139/440 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQSLDF 74
            |..:|.|.:|:||.|||.|..||...::|:.|||.|.|:.|| .|........:...:.|     
Human    26 DERKGCYSSGETVAGHVLLEASEPVALRALRLEAQGRATAAW-GPSTCPRASASTAALAV----- 84

  Fly    75 DYRVDYFAKIDYF-VGSEAAQPQ------IMEAGTYNYGFHVKLPKN-CPGNFEGGHGHIRYTLQ 131
                  |::::|. |.....:|.      :::.|.:.:.|..:||.. ...:|.|.:|.|:|.::
Human    85 ------FSEVEYLNVRLSLREPPAGEGIILLQPGKHEFPFRFQLPSEPLVTSFTGKYGSIQYCVR 143

  Fly   132 VLIHSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQ---------TPRLR---------- 177
            .::    :||.          .|..|:.:     |:|:...         ||.|:          
Human   144 AVL----ERPK----------VPDQSVKR-----ELQVVSHVDVNTPALLTPVLKTQEKMVGCWF 189

  Fly   178 FWMKPLHLQLQIPRQGYSPGAGISVHLKLHN-PEKLTLREAVYSLVQISTYVAHLKNKPKRLETK 241
            |...|:.|..:|.|:||..|..|.::.::.| ..:|.:.:|  ::.|..||:|..|.|       
Human   190 FTSGPVSLSAKIERKGYCNGEAIPIYAEIENCSSRLIVPKA--AIFQTQTYLASGKTK------- 245

  Fly   242 VERQTVLSSRHELHNLPRGELQNFQHL----------HMLQVPQTAATLTVAGCACLQLNYEVEV 296
                   :.||.:.|: ||     .|:          ..|::|  ..|.::..|..::::|.:.|
Human   246 -------TIRHMVANV-RG-----NHIASGSTDTWNGKTLKIP--PVTPSILDCCIIRVDYSLAV 295

  Fly   297 LVTTQQEKRLIAARMPVIIGNVTPPCPGKLLMQEPIDGTAPEPTPPVETASTLIPNFSISTTSLA 361
            .:.....|:|: ..:|::||.:            |.:|                  |....:|:|
Human   296 YIHIPGAKKLM-LELPLVIGTI------------PYNG------------------FGSRNSSIA 329

  Fly   362 SNF-REAEFMVATNLNKTNKHYLSGEQLDFRPRYVYYEMDQTQSEEVKSH 410
            |.| .:..::..|          ..||.:..|.|.    |....||...|
Human   330 SQFSMDMSWLTLT----------LPEQPEAPPNYA----DVVSEEEFSRH 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 35/138 (25%)
Arrestin_C 179..322 CDD:214976 34/153 (22%)
ARRDC4NP_899232.2 Arrestin_N 26..169 CDD:278754 41/173 (24%)
Arrestin_C 191..318 CDD:214976 34/163 (21%)
PPxY motif 1. /evidence=ECO:0000305 350..353 1/2 (50%)
PPxY motif 2. /evidence=ECO:0000305 395..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.