DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and LDB19

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_014967.3 Gene:LDB19 / 854500 SGDID:S000005849 Length:818 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:56/293 - (19%)
Similarity:109/293 - (37%) Gaps:103/293 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 NSLSQETRSCEIQIYEQTPRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYS 220
            :::|..|.|..|   ..:|      .|.:|::.   .||:               |:|:.....|
Yeast   110 SNISPSTSSTSI---SHSP------TPANLRIM---AGYT---------------KITITSVTLS 147

  Fly   221 LVQ----ISTYVAHLKNKPKRLETKVERQTVLSSRHELHNLPRGELQN-------------FQHL 268
            |||    ...:|.::.:          .||.::.:.::.|:...|:|:             |.:|
Yeast   148 LVQKIHFHKPFVPNISS----------MQTCMNCKTKITNMKSWEIQSNTQDLSVGSHSYPFSYL 202

  Fly   269 HMLQVPQTAATLTVAGCACLQLNYEVEVLVT--------------------TQQEKRLIAARMPV 313
            ....||   .:.::...|..|:.||:..:||                    :..:|||:...||:
Yeast   203 IPGSVP---CSSSLGATAETQVKYELIAVVTYIDPHRNSFSSGHSTPRKEGSSSKKRLLQLAMPI 264

  Fly   314 IIGNVTPPCPGKLLMQEPIDGTAPEPTPPVE-TASTLIPNFSISTTSLASNFREAEFMVATNLNK 377
            .:....|..|         |..:....||.| ||:.::||..         :.::.|.:...|:.
Yeast   265 AVTRSIPRGP---------DKNSLRVFPPTELTAAAVLPNVV---------YPKSTFPLEMKLDG 311

  Fly   378 TNKHYLSGEQLDFRPRYVYYEMDQTQSEEVKSH 410
            .:    ||:: .:|.|.:.:.:::|  ..||:|
Yeast   312 VS----SGDR-RWRMRKLSWRIEET--TRVKAH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627
Arrestin_C 179..322 CDD:214976 32/179 (18%)
LDB19NP_014967.3 LDB19 144..346 CDD:404030 45/232 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.