DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and ALY2

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_012451.1 Gene:ALY2 / 853361 SGDID:S000003620 Length:1046 Species:Saccharomyces cerevisiae


Alignment Length:384 Identity:70/384 - (18%)
Similarity:123/384 - (32%) Gaps:123/384 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 FVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQVLIHSSADRP---------L 142
            |......:..:.:.|.|.|.|...:|:..|.:.:...|.:.|    .:.:|.:||         .
Yeast   274 FTSGSGGEFFVFQPGDYIYAFEELIPQAYPESIKADFGFVEY----FLFASIERPGAFKSNISAR 334

  Fly   143 EVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRL--RFWMKPLHLQLQIPRQGYSPGAGISVHLK 205
            :|:::.:.|  ..||           :.|..|.:  |.|...|:..:.|..:.....|.:.:..|
Yeast   335 QVVNIVRTQ--AHNS-----------VEESEPIIISRDWENQLYYDIVIASKDIILDAFLPITFK 386

  Fly   206 LHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRHELHNLP------------ 258
            ....:|:||......:.:...|....| |..|:|...:.........:|.|||            
Yeast   387 FAPLDKVTLHRIRIYVTETMEYYCREK-KVHRMEPTKKFLLTEQKGPKLPNLPNDANLSKAKNMG 450

  Fly   259 -------RGEL---------------QNFQHLHMLQVPQTAATLTVAG---CACLQL-------- 290
                   .|:|               .|.|.||    |.|:.....|.   ..||:|        
Yeast   451 NLLQDPKNGDLVNKEYEYQIFIPSRFNNHQQLH----PDTSYENIKANHWIKICLRLSRVVDNKR 511

  Fly   291 -NYEVEVLVTTQQEKRLIA---ARMPVIIGNVTPPCPGKL----------LMQEPIDG------- 334
             :||:.:........||.:   ..:|...|:     |...          :::...|.       
Yeast   512 KHYEISIDSPIHVLHRLCSHANTLLPSYDGH-----PASFPKETDSSISSILESSDDNINLYHNS 571

  Fly   335 ---------TAPEPTPPVETASTLIPNFSISTTSLASNFREAEFMVATNLNKTNKHYLS 384
                     ::|..:|.|:....|||:  :.:|||..|.|:        .|:.:|.:.|
Yeast   572 NIFFPKEVLSSPVLSPNVQPLDILIPH--LPSTSLTRNSRQ--------FNRNSKSHPS 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 10/53 (19%)
Arrestin_C 179..322 CDD:214976 35/191 (18%)
ALY2NP_012451.1 Arrestin_N <254..341 CDD:419887 13/70 (19%)
Arrestin_C 360..526 CDD:214976 31/170 (18%)
PTZ00112 620..>924 CDD:240274 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343395
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.