DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and RIM8

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_011470.4 Gene:RIM8 / 852837 SGDID:S000003013 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:380 Identity:80/380 - (21%)
Similarity:136/380 - (35%) Gaps:94/380 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQLDNPRGVYRAGDTVNGHVYLTLSE---RALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVV 68
            |.:|.|..|::..:::.|...:.:..   ...|| :.|.......|......|:|..:|     .
Yeast    41 IDIDEPHRVWKPNESITGEAVIDIKRDITNVAIK-LSLVCEVRVKTGNSPTSKNKRIEK-----T 99

  Fly    69 VQSLDFDYRVDYFAKIDYFVGSEAAQPQI--------MEAGTYNYGFHVKLPKN----CPGNFEG 121
            ::...|.|..||   :.....::..:|.:        :..|.:.:.|.:::|:.    ....|| 
Yeast   100 LEKSTFLYGQDY---VKTAFSAKEKKPHVDKTTILNGLSKGEHRFPFRIRIPRGRGMLSSIKFE- 160

  Fly   122 GHGHIRYTLQVLIHS------------SADR------PLEVLH---------VRQLQIFPQNSLS 159
             .|.|.|.|...:.|            ..:|      ||:|..         |.|.....||..:
Yeast   161 -RGSITYFLSCTLESLNNINGLKKPEARCEREFAVIVPLDVSRLPKPKTKTVVLQSASMVQNKKN 224

  Fly   160 QET-----------------RSCEIQIYEQTPRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKL- 206
            :.|                 .|....:..:|..|.  .|.:.:.:.||:.|:..|..|.:.:|: 
Yeast   225 KSTEDESSSYTQLTQKSTTSNSSSSSVNSKTSPLP--NKTVTISVDIPQAGFMIGEIIPIDVKID 287

  Fly   207 -----HNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRHELHNLPRGELQNFQ 266
                 :.|..||.     :||:|.......|:.|  :||  .|:.:..|...::..|  |...||
Yeast   288 HYKPFYAPAGLTT-----TLVRICRVGGAGKDDP--MET--FRKDICQSISPIYINP--ETLQFQ 341

  Fly   267 HLHMLQVPQTA-ATLTVAGCACLQLNYEVEVLVTTQQEKRLIAARMPVIIGNVTP 320
            ....|:||..| :|||..| ......|.:||:|.. .:|.::......|||  ||
Yeast   342 SRVYLKVPLDAFSTLTTVG-KFFSFQYYIEVMVNL-SKKNVVYTESNRIIG--TP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 28/166 (17%)
Arrestin_C 179..322 CDD:214976 41/149 (28%)
RIM8NP_011470.4 Arrestin_N 39..201 CDD:419887 30/170 (18%)
Arrestin_C 259..392 CDD:397050 39/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.