DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and ART10

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_013496.3 Gene:ART10 / 851108 SGDID:S000004384 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:49/216 - (22%)
Similarity:85/216 - (39%) Gaps:56/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHRCEIQLDNPRG--VYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKN 63
            |:.:..|.|:.|..  .|.:.|.::|.|.|.|::...|:.|.:...|::.|..:..|::..| :|
Yeast     1 MAPKISISLNPPYNGEFYSSNDQMSGIVSLQLTKALSIRKISVILKGFSETLTKIDQEYMFQ-QN 64

  Fly    64 EQPVVVQS-------LDFDYRV----DYFAKIDYFVGSEAAQPQIMEAGTYNYGFHV-KLPK--N 114
            ...:..|.       :.|:.||    :.:..:|   ||  ::|..::.|:|||.|.. |.|:  .
Yeast    65 GMMMPGQDNKSFHTLMKFEQRVFPPDNVWNALD---GS--SKPFKVKPGSYNYSFQFDKFPRKPE 124

  Fly   115 CPGNFEGGHGHIRYTLQVLIHSSADRPLEVLHVRQLQIFPQ-NSLSQETRSCE------------ 166
            |..|      |...|:..:..|:|..|            |. ||..||....:            
Yeast   125 CLKN------HTAKTVAFVTRSNARLP------------PTFNSHWQEFNKIDNLDLYFYSFGKV 171

  Fly   167 ---IQIYEQTPRLRFWMKPLH 184
               :|:..:..:...|.||.|
Yeast   172 IYMVQVQLELGKSSSWFKPFH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 37/151 (25%)
Arrestin_C 179..322 CDD:214976 4/6 (67%)
ART10NP_013496.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.