DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and ROG3

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_116677.3 Gene:ROG3 / 850578 SGDID:S000001918 Length:733 Species:Saccharomyces cerevisiae


Alignment Length:473 Identity:76/473 - (16%)
Similarity:158/473 - (33%) Gaps:131/473 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VNGHVYLTLSERALIKAICLEANG--YASTAWQQPQKHKNQKKNEQPVVVQSLD---FDY----- 76
            ::|.:.|:::|...||:|.|...|  ......::||...:...:..|..::..:   ::|     
Yeast    42 LSGCIVLSINEPMQIKSISLRLYGKIQIDVPLERPQDASSSSLSSSPPKIRKYNKVFYNYAWDNV 106

  Fly    77 -----------------------------RVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLP 112
                                         |....:.:....||.:.....::.|.|::.|...||
Yeast   107 NLKEYLSGLRGQSGLAGSSSSSNILGTRQRAQSTSSLKSLKGSSSPSSCTLDKGNYDFPFSAILP 171

  Fly   113 KNCPGNFEG-GHGHIRYTLQVLIHSSAD-------RPLEVLHVRQLQIFPQNSLSQETRSCEIQI 169
            .:.|.:.|. .:..:.|:::.:|..|.:       :.:.||..    |.|          ..:::
Yeast   172 GSLPESVESLPNCFVTYSMESVIERSKNYSDLICRKNIRVLRT----ISP----------AAVEL 222

  Fly   170 YEQTPRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNK 234
            .|.......|...:...:.:|.:..:.|:...:::.: .|....|:.....:|....|.......
Yeast   223 SETVCVDNSWPDKVDYSISVPNKAVAIGSATPINISI-VPLSKGLKLGSIKVVLFENYQYCDPFP 286

  Fly   235 PKRLETKVERQTVLSSRHELHNLPRGELQN---------FQHLH----------MLQVPQTAATL 280
            |...|   .||....:..:..|...||...         ||..|          :||:|.:.:. 
Yeast   287 PVISE---NRQVTELNLEDPLNESSGEFNGNGCFVNNPFFQPDHSFQDKWEIDTILQIPNSLSN- 347

  Fly   281 TVAGC---ACLQLNYEVE---VLVTTQQEKRLIAARMPVIIGNVTPPCPGKLLMQEPIDGTAPEP 339
            .|..|   :.:::.::::   :|:.....|..:.|.:|:            .|...|....:.:|
Yeast   348 CVQDCDVRSNIKVRHKLKFFIILINPDGHKSELRASLPI------------QLFISPFVALSIKP 400

  Fly   340 TPPVETASTLIPNFSISTTSL----ASNFREAEFMVATNLNKTNKHYLSGEQLDFR--------- 391
            .    ::|.|...|  |||:.    :|...|.|::.:.:.:.|....|:    |.|         
Yeast   401 L----SSSNLYSLF--STTNQKDENSSQEEEEEYLFSRSASVTGLELLA----DMRSGGSVPTIS 455

  Fly   392 -----PRYVYYEMDQTQS 404
                 |.|..:..|:..|
Yeast   456 DLMTPPNYEMHVYDRLYS 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 25/165 (15%)
Arrestin_C 179..322 CDD:214976 26/167 (16%)
ROG3NP_116677.3 Arrestin_N <156..215 CDD:419887 12/62 (19%)
Arrestin_C 232..393 CDD:214976 27/177 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.