DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and LOC799768

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_009300042.3 Gene:LOC799768 / 799768 -ID:- Length:377 Species:Danio rerio


Alignment Length:396 Identity:88/396 - (22%)
Similarity:156/396 - (39%) Gaps:93/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQLD--NPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQK--HKNQKKNEQPV 67
            :|.|  |....:.:||.|.|.|.|.:::...:.::.::..|.|...|.:.:.  |.:::      
Zfish    33 LQYDQINESNTFNSGDIVEGRVLLEVTKNLTVDSLFVKFTGGAKVYWTEGESKYHDHER------ 91

  Fly    68 VVQSLDFDYRVDYF-AKIDYFVGSEAAQPQIMEAGTYNYGFHVKLP-KNCPGNFE----GGHGHI 126
                        || .|.|...|....:.||:..|.:...|..:|| :|.|.:|:    |.:..|
Zfish    92 ------------YFKLKQDLTPGRSGKERQIISPGRHVLPFKFQLPEQNLPPSFKEKVSGFNCWI 144

  Fly   127 RYTLQVLIHSSADRPLEVLHV--RQLQIFPQNSLSQETRSCEIQIYEQTPRLR--FWMKPLHLQL 187
            ||.|.    :...||.:....  .:|...|:   |..|....::...:|.:::  |....:.|..
Zfish   145 RYALT----AKLKRPFKSASTAYAELTFVPR---SHVTNDHLLKPQNRTDKMKNTFSSGKISLTA 202

  Fly   188 QIPRQGYSPGAGISVHLKLHNPEKLTLREA--VYSLVQISTYVAHLKNKPKRLETKVERQTVLSS 250
            ...:.||..|..|.|.:.:.|...   |:|  .|||.|...::|              .:|...|
Zfish   203 TTDKTGYMLGETIKVCVDIDNASS---RDAKLKYSLKQQQMFIA--------------SRTTKRS 250

  Fly   251 RHELHN----LPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNY--EVEVLVTTQQEKRLIAA 309
            :|.:..    :|.||.:.|  |..:::|:. ..::...|..:::.|  :|.:.|:...:.   |.
Zfish   251 KHIIQETSDCIPSGEKRRF--LVNIKLPRD-IMVSFENCRIIRVLYLLKVSLDVSFASDP---AV 309

  Fly   310 RMPVIIGNVTPP---C------PGKLLMQEPI--DGTAP-------EPTPPVETASTLIPN--FS 354
            :.||:|   .||   |      |...:..:|:  .|.||       :|.||...|:..:|.  |.
Zfish   310 KFPVVI---IPPLQQCPPWQDPPPPYMPPQPVPHPGGAPPPFARLYDPVPPNPGAAAGLPGSPFG 371

  Fly   355 ISTTSL 360
            ..:|||
Zfish   372 FVSTSL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 32/143 (22%)
Arrestin_C 179..322 CDD:214976 33/153 (22%)
LOC799768XP_009300042.3 Arrestin_N 39..158 CDD:328947 32/140 (23%)
Arrestin_C 194..319 CDD:308405 32/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.