DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Arrdc5

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_084075.1 Gene:Arrdc5 / 76920 MGIID:1924170 Length:325 Species:Mus musculus


Alignment Length:326 Identity:72/326 - (22%)
Similarity:133/326 - (40%) Gaps:45/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQSLDFDYRVD 79
            ||.||..::|.|.|||:...:...:.:|..|.....|       |::..|.....:.:..:.:.|
Mouse    16 VYLAGSIIDGQVVLTLNSTLVDPVVKVELVGRGYVEW-------NEEIGETRDYSRDVICNNKAD 73

  Fly    80 YFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQVLI----HSSADR 140
            |..|...|    ..:...:.||::.:.||..||...|..|....|||.|.:|.|.    |..|.:
Mouse    74 YVHKTKTF----PIKDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFVQALCLDREHILAKK 134

  Fly   141 PLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRF------WMKPLHLQLQIPRQGYSPGAG 199
            .|.:| |:.:..|.|.:||:.:.|.|.:     .::.:      |:. ||:|:.  :..|.||..
Mouse   135 KLYLL-VQGISEFRQRNLSENSVSVEAE-----KKVSYNCCSQGWVS-LHVQMS--KNTYVPGEK 190

  Fly   200 ISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRHELHNLPRGELQN 264
            ::...::.|.....::..|::|      .||::.  :......||:....|...|..:....:..
Mouse   191 VTFTSEIRNHTGKYIKTVVFAL------YAHVQY--EGFTPSAERRRRADSSELLRQMANARIPA 247

  Fly   265 FQHLHMLQVPQTAATLTVAGCA----CLQLNYEVEVLVTTQQEKRLIAARMPVIIGNV---TPPC 322
            |....::........|:|:..:    .::.:||:.|.:........:.||:|:||.:.   ...|
Mouse   248 FNSTTVVSAFNLPLVLSVSSGSQENEIMRTSYELVVTIHLPWSLSTVKARLPIIITSTREGQADC 312

  Fly   323 P 323
            |
Mouse   313 P 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 34/129 (26%)
Arrestin_C 179..322 CDD:214976 27/149 (18%)
Arrdc5NP_084075.1 Arrestin_N 13..128 CDD:304627 32/122 (26%)
Arrestin_C 170..304 CDD:280848 27/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.