DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Arrdc5

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001102878.1 Gene:Arrdc5 / 680452 RGDID:1591748 Length:325 Species:Rattus norvegicus


Alignment Length:323 Identity:72/323 - (22%)
Similarity:130/323 - (40%) Gaps:39/323 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQSLDFDYRVD 79
            ||.||..::|.|.|||:...:...:.:|..|.....|       |::..|.....:.:..:.:.|
  Rat    16 VYLAGSNIDGQVVLTLNSTLVDPVVKVELVGRGYVEW-------NEEIGETRDYSRDVICNNKAD 73

  Fly    80 YFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQVLI----HSSADR 140
            |..|...|    ..:...:.||::.:.||..||...|..|....|||.|.:|.|.    |..|.:
  Rat    74 YVHKTKTF----PIKDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFVQALCMGREHILAKK 134

  Fly   141 PLEVLHVRQLQIFPQNSLSQETRSCEIQ---IYEQTPRLRFWMKPLHLQLQIPRQGYSPGAGISV 202
            .|.:| |:.:..|.|.:||:...|.|.:   .|....  |.|:. ||:|:.  :..:.||..::.
  Rat   135 RLYLL-VQGISEFRQRNLSENPLSVEAEKKVSYNCCS--RGWVS-LHVQMS--KNTFVPGEKVTF 193

  Fly   203 HLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRHELHNLPRGELQNFQH 267
            ..::.|.....::..|::|      .||::.  :......||:....|...|..:....:..|..
  Rat   194 TSEIRNHTGKYIKTVVFAL------YAHVQY--EGFTPSAERRRRADSSELLRQMANARIPAFNS 250

  Fly   268 LHMLQVPQTAATLTVAGCA----CLQLNYEVEVLVTTQQEKRLIAARMPVIIGNVTPP---CP 323
            ..::........|:|:..:    .::.:||:.|.:........:.|.:|:||.:....   ||
  Rat   251 TTVVSAFNLPLVLSVSSGSQENEIMRTSYELVVTIHLPWSLSTVKAGLPIIITSAREDKANCP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 34/129 (26%)
Arrestin_C 179..322 CDD:214976 25/149 (17%)
Arrdc5NP_001102878.1 Arrestin_N 13..124 CDD:419887 31/118 (26%)
Arrestin_C 170..304 CDD:397050 26/146 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.