DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and ARRDC5

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001354118.1 Gene:ARRDC5 / 645432 HGNCID:31407 Length:350 Species:Homo sapiens


Alignment Length:378 Identity:73/378 - (19%)
Similarity:129/378 - (34%) Gaps:88/378 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQ 70
            |:.|...| :|.||.::.|.|.|||:...:...:.:|..|.....|.:.             ...
Human     8 ELVLPEDR-IYLAGSSIKGQVILTLNSTLVDPIVKVELVGRGYVEWSEE-------------AGA 58

  Fly    71 SLDFDYRV------DYFAKIDYFVGSEAAQPQIMEAG--------------TYNYGFHVKLPK-- 113
            |.|:...|      ||..|...|...|.|...:.:||              |:....|:.|..  
Human    59 SCDYSRNVICNNKADYVHKTKTFPVEEMASRSVTQAGVQWHDLGSLQPPSRTFKLSSHLSLLSTW 123

  Fly   114 --NCPGNFEGGHGHIRYTLQVLIHSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRL 176
              ..|..|....||:.|.:|.   |...|. .:|..:::.:..|.:.:         .:::||  
Human   124 NYRLPSTFTSKFGHVFYFVQA---SCMGRE-HILAKKRMYLLVQGTST---------FHKETP-- 173

  Fly   177 RFWMKPLH------------------LQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQ 223
              :..||.                  ||:|:.|..::||..:....:::|.....::..|::|  
Human   174 --FQNPLFVEAEEKVSYNCCRQGTVCLQIQMERNTFTPGEKVVFTTEINNQTSKCIKTVVFAL-- 234

  Fly   224 ISTYVAHLKNKPKRLETKVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCA-- 286
                .||::.  :......||::.|.|...|.......:..|....::........|:|:...  
Human   235 ----YAHIQY--EGFTPSAERRSRLDSSELLRQEANTPVTRFNTTKVVSTFNLPLLLSVSSSTQD 293

  Fly   287 --CLQLNYEVEVLVTTQQEKRLIAARMPVIIGNVTPPCPGKLLMQEPIDGTAP 337
              .:...||:...|........:.|::|:||   |.......:.|...||..|
Human   294 GEIMHTRYELVTTVHLPWSLTSLKAKVPIII---TSASVDSAICQLSEDGVLP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 35/158 (22%)
Arrestin_C 179..322 CDD:214976 29/164 (18%)
ARRDC5NP_001354118.1 Arrestin_N 13..146 CDD:328947 32/149 (21%)
Arrestin_C 192..326 CDD:308405 26/144 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.