DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and CG18748

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001097703.1 Gene:CG18748 / 59144 FlyBaseID:FBgn0042105 Length:409 Species:Drosophila melanogaster


Alignment Length:434 Identity:112/434 - (25%)
Similarity:189/434 - (43%) Gaps:69/434 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CEIQL-DNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVV 68
            |:|.. :|.:||:.||..|.|.|.|:..:...||||.|:..|||.|.|.:.:...|.|...:   
  Fly     5 CQILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKAIRLKLKGYAETHWTESKTDSNNKSTSE--- 66

  Fly    69 VQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQVL 133
                .::....|.:...|.:|||.:....:|.||.:|.|...:|.|||.:|||.||.|||.:.|.
  Fly    67 ----SYNGFEKYLSSKVYLLGSEISPEMALEPGTRSYNFACPIPINCPSSFEGTHGRIRYMVDVN 127

  Fly   134 I------HSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRL----RFWMKPLHLQLQ 188
            |      .|...|...|:.|..:..:  ||:||      :.:..:|.:.    .|...||.|:|.
  Fly   128 IIQPWKYDSIFSRAFTVIQVMDINTY--NSVSQ------VPVQAKTEKTFGVWPFRSDPLTLELN 184

  Fly   189 IPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRHE 253
            :|:.|:.||..:..::.:.|..|:.:.|....|..:.||.:.|.:     .:|.||::|...:.:
  Fly   185 LPQTGFVPGQTVPANVLIGNESKIRVHEVKVGLSMMITYYSDLSS-----GSKCERKSVAKLKAD 244

  Fly   254 LHNLPRGELQNFQHLH--MLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLIAARMPVIIG 316
                  |.|:|.:.::  .|.:|.|..:.... |..:::.|::||:...:.........|||.|.
  Fly   245 ------GVLRNSRKMYDFQLMIPSTPPSCFHL-CRIIKIGYQIEVVAKVKGMHINGTLIMPVTIC 302

  Fly   317 NVTPPCPGKLLMQEPIDGTAPEPTP-------PVETASTLI----------PNFSISTTSLASNF 364
            .|            ||..:|.:.||       |.:.|.|||          |.:..|..|..|..
  Fly   303 GV------------PISPSAVQYTPQSSGPEAPEQRALTLIEGEGAFAPAAPPYPWSEGSTLSPP 355

  Fly   365 REAEFMVATNLNKTNKHYLSGEQLDFRPRYVYYEMDQTQSEEVK 408
            ..||.|.:.:.::......:.::..::|.|..:::..:..|:.|
  Fly   356 NYAEAMHSHSDSEKQSESGNAQEKSYKPLYPVFDLSTSTVEKSK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 48/142 (34%)
Arrestin_C 179..322 CDD:214976 34/144 (24%)
CG18748NP_001097703.1 Arrestin_N 5..151 CDD:278754 51/152 (34%)
Arrestin_C 175..301 CDD:280848 32/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464083
Domainoid 1 1.000 52 1.000 Domainoid score I3293
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
98.900

Return to query results.
Submit another query.