DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and CG18747

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_652650.2 Gene:CG18747 / 59143 FlyBaseID:FBgn0042104 Length:418 Species:Drosophila melanogaster


Alignment Length:434 Identity:115/434 - (26%)
Similarity:182/434 - (41%) Gaps:82/434 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CEIQLDNPR-GVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVV 68
            |||..||.: |.:.||..|.|...|.......::|:.|:..||:.|.|.:               
  Fly     5 CEISFDNNKHGTFYAGQLVKGCATLKCDRSKEVQAVLLKVVGYSITKWSE--------------- 54

  Fly    69 VQSLD----FDYRVDYFAKIDYFVGSEAAQPQ------IMEAGTYNYGFHVKLPKNCPGNFEGGH 123
             :||.    :..|.||.:...|.||||.....      .:|||.::|.|..:||..||.:|||.|
  Fly    55 -KSLGSTKLYVGREDYLSSNTYLVGSEQNNTHNNTHRLTIEAGVHSYNFTCQLPYQCPSSFEGRH 118

  Fly   124 GHIRYTLQVLIHSSADRP--LEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFW-----MK 181
            |.|||.::||:    .||  .:..:.:...:.....|:.:|...:...:.:..| .|.     ..
  Fly   119 GCIRYIVKVLL----IRPWKFDQAYTKGFTVLKMLDLNFDTPQLKSAAHSEGYR-TFCCGPCKTD 178

  Fly   182 PLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQT 246
            ||.|:|.:|:.||.||..|.|.:.:.|...:.:.|...|||.:   |.:....|:  .::|||..
  Fly   179 PLKLELHLPQAGYVPGQKIPVTIVVVNNTAVAVSEIRLSLVML---VRYYSVSPE--HSRVERLI 238

  Fly   247 VLSSRHE--LHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLN--------YEVEVLVTTQ 301
            :..::.|  |....|.:..:      |.||.|..|       |::|:        .|||.||.:.
  Fly   239 ISRAKGESVLKQCTRSQTID------LPVPSTPPT-------CVELSNLIQIAYQLEVEALVKSL 290

  Fly   302 QEKRLIAARMPVIIGNVTPPCPGKLLMQEP-----IDGTAPEPTPPVE----TASTLIPN--FSI 355
            :|::|:.  |||.:|.:.....|.::.|.|     .:|......||.|    ||...:|:  .|.
  Fly   291 REQQLMV--MPVTVGTIPLAVSGIVVQQPPRRSAHYEGPDSRRNPPDELPMVTALESLPSDLASS 353

  Fly   356 STTSLASNFREAEFMVATNLNKTNKHYLSGEQLDFRPRYVYYEM 399
            :..|...|:.|:......|:|:...|.....  :|.|.|..|.:
  Fly   354 AADSALPNYEESRHTQRGNINEEELHAFGSN--EFAPLYPVYSI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 46/146 (32%)
Arrestin_C 179..322 CDD:214976 42/157 (27%)
CG18747NP_652650.2 Arrestin_N 5..152 CDD:278754 48/166 (29%)
Arrestin_C 176..307 CDD:214976 42/150 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464079
Domainoid 1 1.000 52 1.000 Domainoid score I3293
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
98.900

Return to query results.
Submit another query.