DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and CG18746

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_652649.1 Gene:CG18746 / 59142 FlyBaseID:FBgn0042103 Length:438 Species:Drosophila melanogaster


Alignment Length:448 Identity:113/448 - (25%)
Similarity:184/448 - (41%) Gaps:85/448 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CEIQL-DNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVV 68
            |||:. :|.:|::.||..::|.|.:...:...:||:.|...|||.|.|...:...:.:.|.:   
  Fly     4 CEIEFCNNSQGIFYAGQLISGQVVIKTEKEKSVKAVILNIKGYAETHWADTEHDPDDQSNGE--- 65

  Fly    69 VQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQV- 132
                .|:..|||.|...|..||.::...::|.||.:|.|..:||..||.:|||..|.|||.:.| 
  Fly    66 ----SFNGHVDYLATRAYLHGSSSSIEVLIEPGTSSYRFACQLPITCPSSFEGTLGRIRYLVNVR 126

  Fly   133 -----LIHSSADRPLEVLHVRQLQI------FPQNSLSQETRSCEIQIYEQTPRLRFWMKPLHLQ 186
                 ....:.:|...|:.|..|..      .|....||.|..|          ......||.::
  Fly   127 FVRPWKFDLNFNRCFTVIKVMDLNSESLMLRVPSQVESQRTFCC----------FPCRSSPLSMR 181

  Fly   187 LQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVER-QTVLSS 250
            |.:|:.|:.||..:.|.:.:.|...:.:.:....|..:..|.    ::|...:|..:| :.||.:
  Fly   182 LSVPQSGFVPGQIVPVEVMVSNDSGVAVEDITVKLTMVVIYY----SQPPSADTNKDRFEMVLKT 242

  Fly   251 RHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRL------IAA 309
            ...:....|.     |....|:||.|..|.... |:.:|:.|:||.      |.|:      .:.
  Fly   243 GGGVSTKCRQ-----QFTFDLKVPPTPPTCFNL-CSIIQIGYQVEA------EARVKGCHGGQSL 295

  Fly   310 RMPVIIGNVTPPCPGKLLMQEPIDGTAPEPTPPVE-TASTLI-------------PNFSISTTSL 360
            .||:.||:|  |.. |.|.:||  .|..|..||.: .|..||             ||...:..|:
  Fly   296 HMPITIGSV--PLT-KQLQKEP--RTWGEVLPPQQLDAKALILIGSEQNGEALGSPNPWAADPSI 355

  Fly   361 A-SNFREAEFM------VATNLNKTNKHYLSGEQ------LDFRPRYVYYEMDQTQSE 405
            | .::.||:.:      .:.:..|:.|..:.|.|      :.|.|.|..:::.....|
  Fly   356 APPSYAEAKHISPDPHKFSKSKKKSQKRGVKGSQERKAETIVFSPLYAVFDLSNQVDE 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 43/142 (30%)
Arrestin_C 179..322 CDD:214976 35/149 (23%)
CG18746NP_652649.1 Arrestin_N 4..150 CDD:278754 46/152 (30%)
Arrestin_C 174..306 CDD:214976 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464087
Domainoid 1 1.000 52 1.000 Domainoid score I3293
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
98.900

Return to query results.
Submit another query.