DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrdc1b

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001352163.1 Gene:arrdc1b / 570029 ZFINID:ZDB-GENE-080515-2 Length:443 Species:Danio rerio


Alignment Length:368 Identity:80/368 - (21%)
Similarity:143/368 - (38%) Gaps:80/368 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAI---CLEANGYAS----TAWQQPQKHKNQKKN 63
            ||...|.:.||..|::::|.|.:..|.....|||   |:.:.|.:|    .:|...:|:.:...:
Zfish     8 EITFTNNKVVYNPGESISGTVRIKSSHSLQFKAIKVCCVGSCGISSKLNDASWMLEEKYLSSTLS 72

  Fly    64 EQPVVVQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRY 128
                                        .|....:..|.:::.|...:|.:.|.:|||..|.|.|
Zfish    73 ----------------------------VADKGTLPPGEHSFPFQFLIPASVPTSFEGPFGKILY 109

  Fly   129 TLQVLIHS-------SADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWM---KPL 183
            .::..|.:       .|.||..:|:|..|...|    ..|..||.:    .|.:..:.:   ..|
Zfish   110 KIRAFIDTPRFSKDYK
AQRPFYLLNVLNLNELP----DIEQPSCAV----TTKKFNYLLVKTGTL 166

  Fly   184 HLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVL 248
            .|:.....:||:||..|.:..::||.........:.||:|..:|.........|...:||...|.
Zfish   167 MLKAYTDLRGYTPGQVIKLSAEIHNKSGKDTGYVMASLIQRVSYKTKRPVFDLRPIAEVEGAGVK 231

  Fly   249 SSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLIAARMPV 313
            :.:|       .|.:  :.:.:..:||:..|    ||..:.:.|.::|.:.:.:    .|..:|:
Zfish   232 AGKH-------AEWR--EQIIVPPLPQSGLT----GCNLIDIEYFIQVSLKSPE----AAVTLPI 279

  Fly   314 IIGNV----TPPCPGKLLMQEPIDGTAPEPTPPVETASTLIPN 352
            .|||:    ||..|      .|:....|.||.|....:.::|:
Zfish   280 YIGNIAVNLTPSIP------HPMAHGVPMPTGPSLNPAAVVPS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 30/148 (20%)
Arrestin_C 179..322 CDD:214976 33/149 (22%)
arrdc1bNP_001352163.1 Arrestin_N 7..125 CDD:328947 29/144 (20%)
Arrestin_C 162..284 CDD:308405 30/138 (22%)
Atrophin-1 <293..426 CDD:331285 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.