DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrdc3a

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001073498.1 Gene:arrdc3a / 566685 ZFINID:ZDB-GENE-030131-2913 Length:414 Species:Danio rerio


Alignment Length:345 Identity:77/345 - (22%)
Similarity:147/345 - (42%) Gaps:70/345 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHRCEIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQ 65
            :|:.|....:.|  |:.:||:|:|.|.:.::....:|::.:.|.|:|...|       .:.:|..
Zfish    11 VSYDCLNDSNVP--VFSSGDSVSGRVIIEVTGEIRVKSLKINAKGFAKVRW-------TESRNAG 66

  Fly    66 PVVVQSLDFDYRVDYFAKIDYFVGSEAAQPQIME------AGTYNYGFHVKLPKN-CPGNFEGGH 123
            .....:.::...|:|....|..:|.|.......|      :|.:.|.|..:||:. ...:|||.|
Zfish    67 SSTAYTQNYTEEVEYLNHRDILIGHERDDDNSEEGLTTIHSGRHEYAFSFELPQTPLATSFEGKH 131

  Fly   124 GHIRYTLQVLIHSSADRP--LEVLHVRQLQIF------------PQNSLSQETRSCEIQIYEQTP 174
            |.:||.::..:|    ||  |.:...::..:|            ||....::|..|         
Zfish   132 GSVRYWVKAELH----RPWLLPMKTKKEFTVFEHIDINTPLLLSPQAGTKEKTLCC--------- 183

  Fly   175 RLRFWM---KPLHLQLQIPRQGYSPGAGISVHLKLHN--PEKLTLREAVYSLVQISTYVAHLKNK 234
                |.   .|:.|..:|.|:||:||..|.:..::.|  ...:..:.|:|   |..|:.|..|.|
Zfish   184 ----WFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIY---QTQTFFAKGKMK 241

  Fly   235 P-KRLETKVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLV 298
            . |:|...:..:::.|.:.|..|   |:        ||::|..:.  ::..|:.:::.|.:.|.|
Zfish   242 EIKQLVANIRGESLSSGKTETWN---GK--------MLKIPPVSP--SILDCSIIRVEYSLMVYV 293

  Fly   299 TTQQEKRLIAARMPVIIGNV 318
            .......| :..:|::||.:
Zfish   294 DIPGAMNL-SLNLPLVIGTI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 33/142 (23%)
Arrestin_C 179..322 CDD:214976 35/146 (24%)
arrdc3aNP_001073498.1 Arrestin_N 22..165 CDD:278754 36/155 (23%)
Arrestin_C 188..311 CDD:280848 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.