DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and zgc:110626

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001017889.1 Gene:zgc:110626 / 550588 ZFINID:ZDB-GENE-050417-447 Length:454 Species:Danio rerio


Alignment Length:394 Identity:66/394 - (16%)
Similarity:139/394 - (35%) Gaps:126/394 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQSLDFD 75
            |....:.:||.::|.|.|.:.:...::::.::..|.|:..|       :::..:..|:....:..
Zfish    16 NQNNTFTSGDYISGKVILEVVKDTQMQSLSVKIKGKANVCW-------SERHGKTTVLYSDKEKF 73

  Fly    76 YRVD-YFAKID-------YFVGSEAAQP--QIMEAGTYNYGFHVKLP-KNCPGNFEGGHGHIRYT 129
            |.|: :|.:.|       ..:...:.||  .::..|.:.|.|..:|| ::.|..::|..|.:.||
Zfish    74 YSVERFFVQTDTKHANDHEMLKDPSGQPYSSVVAPGRHVYPFTFQLPLQHFPSTYKGSVGKVLYT 138

  Fly   130 LQVLI----HSSADRPLEVLHV-------------------RQLQIFPQNSLSQETRSCEIQIYE 171
            |:..:    ..|:....|..:|                   :|:..|...|:|            
Zfish   139 LETKLSRSMRVSSKAKAEFNYVPCPVVTNPELMAPQYGTKDKQMSFFTSGSVS------------ 191

  Fly   172 QTPRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKP- 235
                         :.:...:..|..|.|:....::.|.....::.. |.|.:..::.|..|.|. 
Zfish   192 -------------MNISTEKMAYHLGEGLKFLAEVQNNSSRAVKPK-YCLYEKHSFFARGKRKLH 242

  Fly   236 -----KRLETKVE---RQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNY 292
                 |.:...:|   ::|:.:                    :|.:| .:.|:::..|..|::.|
Zfish   243 THDIFKEMGEPIEPSSKKTITT--------------------VLTIP-PSLTVSILNCRILKVEY 286

  Fly   293 EVEVLVTTQ--QEKRLIAARMPVIIGNVTP-----------------PCPGKLLMQEPIDGTAPE 338
            .:.|.:..:  .:..:   :.|::|..|.|                 |.||       |.|..|.
Zfish   287 RLRVYLDVKYASDPEI---KFPIVILPVQPVSGANGARNNDFGIWNQPPPG-------IAGPNPP 341

  Fly   339 PTPP 342
            ||.|
Zfish   342 PTAP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 28/144 (19%)
Arrestin_C 179..322 CDD:214976 23/170 (14%)
zgc:110626NP_001017889.1 Arrestin_N 16..157 CDD:304627 28/147 (19%)
Arrestin_C 187..309 CDD:280848 22/171 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579442
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.