DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and zgc:110353

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001017785.1 Gene:zgc:110353 / 550482 ZFINID:ZDB-GENE-050417-310 Length:319 Species:Danio rerio


Alignment Length:363 Identity:77/363 - (21%)
Similarity:140/363 - (38%) Gaps:117/363 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQLD--NPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVV 69
            |:.|  |.|..:..|||:.|.|.:.:|::..|.::.::|.|.|:.||.:....::          
Zfish     8 IEYDAINDRNTFSNGDTLAGRVIVEVSKQTKITSLTVQAKGKANVAWTETHGEES---------- 62

  Fly    70 QSLDFDYRVDYFAKIDYFVGSEAAQPQ-------IMEAGTYNYGFHVKLP-KNCPGNFEGGHGHI 126
                    |.|:.|..||..:::..|:       .:.||.:.:.|..:|| ::.|.:|:|.||.|
Zfish    63 --------VTYWDKEKYFSQTQSVLPEDKADGSVTLVAGRHVFPFAFQLPNQSLPSSFKGVHGKI 119

  Fly   127 RYTLQVLIHSS----------------ADRPLEVLHVRQ-------LQIFPQNSLSQETRSCEIQ 168
            .|.|...:..|                ||.....|...|       :..|...::|         
Zfish   120 HYRLMAKLSRSFRAASKAEAKFTFVARADYDTSTLTTPQHGSKDKNVMFFASGNIS--------- 175

  Fly   169 IYEQTPRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAV--YSLVQISTYVA-- 229
                            :.:.:|:.||..|.|:.|:.::.|.   :.|:.|  |.:.|..::.|  
Zfish   176 ----------------MDIFLPKTGYQQGEGLIVNGEIVNS---STRKIVPKYIIYQKQSFFAGG 221

  Fly   230 ----H----LKNKPKRLETKVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCA 286
                |    ||.|.:.|        |.|:|..|:.             :|.:|...:: |:..|.
Zfish   222 QRAVHTTEILKEKGEPL--------VSSTRENLYK-------------VLPLPPEISS-TIHNCR 264

  Fly   287 CLQLNYEVEVLVTTQQEKRLIAARMPVII---GNVTPP 321
            .|::.|.::|::.....|..: .::|.|:   .|.|||
Zfish   265 ILKVEYRLKVILDVSFTKNPV-IKLPFIVLPLCNETPP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 38/159 (24%)
Arrestin_C 179..322 CDD:214976 35/158 (22%)
zgc:110353NP_001017785.1 Arrestin_N 6..149 CDD:304627 37/158 (23%)
Arrestin_C 171..293 CDD:280848 32/172 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579484
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.