DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and txnipb

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001239433.1 Gene:txnipb / 448858 ZFINID:ZDB-GENE-040917-1 Length:378 Species:Danio rerio


Alignment Length:386 Identity:78/386 - (20%)
Similarity:171/386 - (44%) Gaps:78/386 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGV-YRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVV 69
            |:|:.:|..: |..||.|.|.|.:.::|...:.|:.|...|.|...:::.:.|.:::       :
Zfish    12 EVQMSDPNKIAYSGGDKVAGRVIVEVAELLKVSAVKLFGVGCAKVNYKKGKLHCSEE-------I 69

  Fly    70 QSLDFD--YRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKN-C-PGNFEGGHGHIRYTL 130
            :.|.::  ..:|:.:..| ..||...:|    ...|.:.|..:||:: | ..::||..|.::|.:
Zfish    70 EYLKYEEILHLDHHSTTD-DEGSITLRP----GNRYEFMFGFELPQSGCLVSSYEGKFGSVQYYV 129

  Fly   131 QVLIHSSAD------------RPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWMKPL 183
            :.::..|:.            .|::| :.::| :.|.....|:..:| :.|.:.:         :
Zfish   130 RAVMEKSSQTFAECKRYFEVVEPIDV-N
TQEL-MAPVKGSKQKKVTC-MFIPDGS---------V 182

  Fly   184 HLQLQIPRQGYSPGAGISVHLKLHN-PEKLTLREAVYSLVQISTYVAHLKNKPKRLETKV--ERQ 245
            .:...|.|:||..|..|.:..:..| ..::.:.:|  :::....|:|:.:       |||  |:.
Zfish   183 SIVASIGRKGYCEGEDICIDAQFENTSSRIVIPKA--AIIAKHIYLANGR-------TKVFEEKL 238

  Fly   246 TVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLIAAR 310
            |.:...|.:..:  |::...:   :|:||:...  |:.||..:.::|.:.:.:.....::|| ..
Zfish   239 TSVRGNHIISGM--GDIWQGR---VLRVPKLKP--TILGCDIIHVDYSLRIYLHIPGSEKLI-LE 295

  Fly   311 MPVIIGNVTPPCPG------KLLMQEPIDGTAPE-PTPPVETASTLIPNFSISTTSLASNF 364
            :|::||.:  |..|      .:..||....|... |:.|        |::|..:..:.|:|
Zfish   296 LPLVIGTI--PYNGMNSRTSSMSSQESASSTCVSLPSSP--------PSYSNISNRMDSSF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 31/151 (21%)
Arrestin_C 179..322 CDD:214976 29/145 (20%)
txnipbNP_001239433.1 Arrestin_N 11..156 CDD:304627 33/156 (21%)
Arrestin_C 179..305 CDD:214976 29/153 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.