DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Leash

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_650037.2 Gene:Leash / 41320 FlyBaseID:FBgn0037856 Length:520 Species:Drosophila melanogaster


Alignment Length:437 Identity:97/437 - (22%)
Similarity:171/437 - (39%) Gaps:91/437 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHRCEIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQP 66
            |.|..|.||:...||.|||.:.|.:::.:::|..|:||.::..|.....|.:..: ||...||..
  Fly     3 SERLRITLDSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILR-KNSNNNEYS 66

  Fly    67 VVVQSLDFDYRVDYFAKIDYFVGSEAAQPQI------MEAGTYNYGFHVKLPKNCPGNFEGGHGH 125
               :||       ::...:.:..||...|..      :.||.:.:.|.|.|.:..|.:|:|.:|.
  Fly    67 ---RSL-------FYTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSFKGSYGA 121

  Fly   126 IRYTLQVLIHSSADRP--LEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRL--RFWMKPLHLQ 186
            |:|.::|||    .||  .:..|.....:.....|....||....:.:|..:.  .|..:|:.|.
  Fly   122 IKYKMRVLI----QRPWTFDERHTIPFTVVKNMPLQPMQRSIPSSLEKQVTKTISLFGTRPITLL 182

  Fly   187 LQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLE-----TK----V 242
            ..:|......|..:.:...:.|.....:.:..::::|..||.:|:..:.:::|     ||    |
  Fly   183 ALLPEDFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLRVQKVECIAVATKETGSV 247

  Fly   243 ERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLI 307
            :::|..|..||| .||.|.....:        |.:..:|:.        ||:.|....:...:.:
  Fly   248 QKKTERSFAHEL-LLPDGAQPTDE--------QMSGVITIV--------YELRVEAVLRGFFKNL 295

  Fly   308 AARMPVII---------GNVTPPCPGKLLMQEPIDGTAPEPTPPV------ETASTLIPNF--SI 355
            ...:|..:         .::.||.|.:     |.||   .|.|.:      |.|..:.|:.  ||
  Fly   296 ILNLPFKVYSQDPSNRQSSLRPPPPPR-----PNDG---PPGPELGSGNLFEPALPVYPSLDSSI 352

  Fly   356 STTSLASNFREAEFM---------------VATNLNKTNKHYLSGEQ 387
            .:.|.:|.|.|...:               |.......:..|.||.|
  Fly   353 GSPSHSSQFSECSSINSITSDSSAATLSPAVGAGTGGMDMSYTSGSQ 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 38/141 (27%)
Arrestin_C 179..322 CDD:214976 28/160 (18%)
LeashNP_650037.2 Arrestin_N 6..152 CDD:304627 41/160 (26%)
Arrestin_C 178..305 CDD:280848 27/143 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.