DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and CG18268

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_649739.1 Gene:CG18268 / 40923 FlyBaseID:FBgn0037520 Length:358 Species:Drosophila melanogaster


Alignment Length:334 Identity:67/334 - (20%)
Similarity:140/334 - (41%) Gaps:67/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHRCEIQLDNPRGVYRAGDTVNGHVYLTLSERALIK--AICLEANGYASTAWQQ-----PQ-KH 57
            |...||..|.....:|..|:.::|.:.:|:..:...|  .:.:..:|.::..|::     |: :|
  Fly     1 MPINCEFNLSRAAAIYYNGEQISGSLTVTVDGKKSFKLEGVSVTLHGVSTVHWRESLRGPPEIEH 65

  Fly    58 KNQKKN-EQPVVVQSLDFDYRVDY-FAKIDYFVGSEAAQPQIMEAGTYNYG-FHVKLPKNCPGNF 119
            .:...| |.|          :||| .:|:......:..:...:|.||:..| |:.:||:|.|...
  Fly    66 NDSTGNLECP----------KVDYNGSKVHINETKKLNEVLQLENGTFRLGDFNFQLPENLPATC 120

  Fly   120 EGGHGHIRYTLQVLIHSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWMKPLH 184
            ....|::.|.|:|::.......         :.|.|..:   .|.| :::.:..|:   :|:..:
  Fly   121 RLPFGNVEYVLKVVLERRGTHN---------KCFQQRLV---IRKC-VELADLKPQ---YMETAN 169

  Fly   185 LQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYS-LVQISTYVAHLKNKPKRLETKVERQTVL 248
            :.|.:||..:.||..:|.        ::..::.|.. |.::...:::...:|. .:||...| ||
  Fly   170 MGLTLPRSVFVPGQSVSY--------EICSKDGVQDFLTRLCKKISYTSQQPS-AKTKNVTQ-VL 224

  Fly   249 SSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAG-CACLQLNYEVEVLVTTQQEKRLIAARMP 312
            |...||:.             .|::|.||..::.:. ...:|::|.:|...:..     ...::|
  Fly   225 SESSELNG-------------NLRLPLTAPIMSHSDQLDPIQISYYIETFNSLN-----APIKVP 271

  Fly   313 VIIGNVTPP 321
            :.:..|.||
  Fly   272 IFVATVAPP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 32/146 (22%)
Arrestin_C 179..322 CDD:214976 29/145 (20%)
CG18268NP_649739.1 Arrestin_N 5..153 CDD:304627 34/169 (20%)
Arrestin_C 172..259 CDD:280848 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D817924at2759
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.