DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and CG10086

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster


Alignment Length:472 Identity:122/472 - (25%)
Similarity:189/472 - (40%) Gaps:109/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHRCEIQLD-NPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNE 64
            ||..|.|..| |..|.|..|..:.|.|.:.|::...::.|.|:.:|||...| :.::|......:
  Fly     1 MSKNCMITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQW-RIRRHGKAVAIQ 64

  Fly    65 QPVVVQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYT 129
            .|.......:..|.||.|...|.:|||......|:||||.|.|...:|.:||.:|||.:|||||.
  Fly    65 NPKKRSKHQYSGREDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIRYL 129

  Fly   130 LQVLI---------HSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWM---KP 182
            .:|..         |:.....|::|           .|:|||:........:... .|.:   ||
  Fly   130 AKVTFLKPGASNRTHNVGFTVLKLL-----------DLNQETKMLREPASNEAVE-HFCLMHTKP 182

  Fly   183 LHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTV 247
            :.|::.:.:|||.||..:.:|..:.|......|:.:..|...:||.|...:    |.|..|:  :
  Fly   183 VQLKVTLQQQGYVPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPS----LRTTSEK--I 241

  Fly   248 LSSRHE----LHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACL----QLNYEVEVLVT---TQ 301
            :..:.|    .||..|      .:...|::|.||.|     |..|    :::|||.|:..   ..
  Fly   242 MLVKRECGPVAHNAQR------TYTETLRIPATAPT-----CEHLSKVVRVSYEVRVVAVMNWLM 295

  Fly   302 QEKRLIAARMPVIIGNV----------------------TP---PC------------------P 323
            ...|||   :||.||||                      .|   ||                  .
  Fly   296 ANPRLI---IPVTIGNVPLATAVSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNS 357

  Fly   324 GKLLMQEPIDGTAPEP-TPPVETASTLIPNFSISTTSLASNFREAEFMVATNLNKTNKHYLSGEQ 387
            |..:.::..|...||. ...:|.|...:|:....|      :.:|.|| .|::..|:.:.:| |.
  Fly   358 GYEMAEDLEDFELPEDGDDELEAADDFVPDLPPPT------YEQAMFM-TTDIADTDANTVS-EA 414

  Fly   388 LDFRPRYVYYEMDQTQS 404
            ..|.|||..:::|..||
  Fly   415 SRFTPRYPVFDVDTFQS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 46/145 (32%)
Arrestin_C 179..322 CDD:214976 43/181 (24%)
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 48/163 (29%)
Arrestin_C 179..308 CDD:280848 39/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464086
Domainoid 1 1.000 52 1.000 Domainoid score I3293
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
98.900

Return to query results.
Submit another query.