DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and txnipa

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_956381.1 Gene:txnipa / 368359 ZFINID:ZDB-GENE-030804-10 Length:400 Species:Danio rerio


Alignment Length:436 Identity:88/436 - (20%)
Similarity:168/436 - (38%) Gaps:99/436 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNP-RGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVV 69
            ||..::| :..|.:||.|.|.|.:.:||...:.|:.:...|.|...:   .|.|.:.:.|     
Zfish    12 EIAFNDPSKTFYCSGDKVAGKVLVEVSEVTRVMAMKVLGVGCAKVEY---AKGKQRCREE----- 68

  Fly    70 QSLDFDYRVDYFAKIDYFV---------GSEAAQPQIMEAGTYNYGFHVKLPK--NCPGNFEGGH 123
                    |||....|...         ||...:|    ...|.|.|..:||.  ....:::|..
Zfish    69 --------VDYLKYEDVVQLDEHPTDNDGSVILRP----GNKYEYSFGFELPAQGQLVSSYKGKF 121

  Fly   124 GHIRYTLQVLI------------HSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRL 176
            |.::|.::.|:            |...:.||:| :...| :.|...:.::..:|......|    
Zfish   122 GFVQYYVKALMERPCQPALECKKHFEVEEPLDV-NTPDL-LSPTGGMKEKKVTCMFIPDGQ---- 180

  Fly   177 RFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNP-EKLTLREAVYSLVQISTYVAHLKNKPKRLET 240
                  :.|..:|.|:|:..|..|.:..|..|. .::.:.:|  ::|...||.|:.:       |
Zfish   181 ------VSLNAKIDRRGFCEGEEICIDAKFENTCSRIVVPKA--AIVAKQTYQANGR-------T 230

  Fly   241 KVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKR 305
            ||.||.:.|.|.  :::..|....:|. ..::||:...  ::.||..:::.|.:.:.:.....::
Zfish   231 KVFRQKLSSVRG--NHIISGMCDAWQG-KSIRVPKIKP--SILGCNIIRVEYALMIYMHIPGSEK 290

  Fly   306 LIAARMPVIIGNVTPPCPG------KLLMQEPIDGTAPEPTPPVETASTLIPNFSIST------- 357
            || ..:|::||.|  |..|      .:..|:.....|......:...|:..|::...|       
Zfish   291 LI-LELPLVIGTV--PYNGFGSRTNSMSSQDGSISNASNSWVSLRMPSSAPPSYCDITRDCCIDQ 352

  Fly   358 --TSLASNFREAEFMVATNLNKTNKHYLSGEQLDFRPRYVYYEMDQ 401
              |.|..::...:..:          :::..|..|.|...|.|:::
Zfish   353 PLTPLLDDYDGGDSPI----------FMNAAQFQFPPLPAYSEVEE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 34/158 (22%)
Arrestin_C 179..322 CDD:214976 33/143 (23%)
txnipaNP_956381.1 Arrestin_N 11..155 CDD:304627 37/163 (23%)
Arrestin_C 178..304 CDD:214976 34/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.