DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Arrdc1

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_038961502.1 Gene:Arrdc1 / 366001 RGDID:1309961 Length:466 Species:Rattus norvegicus


Alignment Length:435 Identity:85/435 - (19%)
Similarity:158/435 - (36%) Gaps:120/435 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAI---CLEANGYASTAWQQPQKHKNQKKNEQPV 67
            ||:|...|.||..|:.:.|.|:|.|......:||   |:.:.|.::            |.|:...
  Rat     8 EIRLSQGRVVYSPGEPLAGAVHLRLGAPLPFRAIRVTCMGSCGVSN------------KANDGAW 60

  Fly    68 VVQSLDFDYRVDYFAKIDYFVGS-EAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQ 131
            ||:.             .||..| ..|....:..|.:|:.|...||...|.:|||..|.|.:.  
  Rat    61 VVEE-------------SYFNSSLSLADKGSLPPGEHNFPFQFLLPATAPTSFEGPFGKIVHQ-- 110

  Fly   132 VLIHSSADRP--------------LEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWMKP 182
              :.:|.|.|              |..|::..:....|.:::..|:....::.:        ...
  Rat   111 --VRASIDTPRFSKDHKCSLVFYILSPLNLN
SIPDIEQPNVASTTKKFSYKLVK--------TGS 165

  Fly   183 LHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTY-------------------V 228
            :.|......:||..|..:.:...:.|.........|.||:|:...                   .
  Rat   166 VVLTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQVRAIWFPEPVPFPWDRRGGCQPAQ 230

  Fly   229 AHLKNKPKRLETKVERQTVLSSRHELHNLPRGE---LQNFQHLHMLQ------VPQTAATLTVAG 284
            .|....|:::..|.:|..     :::..:...|   ::.::|....:      :||:|    :.|
  Rat   231 THSPVFPQKVSYKAKRWI-----YDVRTIAEVEGTGVKAWRHAQWQEQILVPALPQSA----LPG 286

  Fly   285 CACLQLNYEVEVLVTTQQEKRLIAARMPVIIGNV----TP--PCPGKLLMQEPIDGTAP------ 337
            |:.:.::|.::|.:...:    ....:|:.:||:    ||  ||||        .|::|      
  Rat   287 CSLIHIDYYLQVSMKAPE----ATVTLPLFVGNIAVNQTPLSPCPG--------PGSSPGLLSPV 339

  Fly   338 -EPTPPVETASTLI--PNFSISTTSLASNFREAEFMVATNLNKTN 379
             ...||.|.|..:.  |:|| ...||::.....:..::|.|...:
  Rat   340 VPSAPPQEEAEAVASGPHFS-DPVSLSTKSHSQQQPLSTTLGSVS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 36/138 (26%)
Arrestin_C 179..322 CDD:214976 27/176 (15%)
Arrdc1XP_038961502.1 Arrestin_N 7..139 CDD:419887 39/159 (25%)
Arrestin_C 162..316 CDD:214976 24/174 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.