DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Arrdc3

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001007798.1 Gene:Arrdc3 / 309945 RGDID:1359478 Length:414 Species:Rattus norvegicus


Alignment Length:444 Identity:100/444 - (22%)
Similarity:174/444 - (39%) Gaps:112/444 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQSLDFDYRVD 79
            ||.:||||:|.|.|.::....:|::.:.|.|:|...|       .:.:|.......:.::...|:
  Rat    23 VYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRW-------TESRNAGSNTAYTQNYTEEVE 80

  Fly    80 YFAKIDYFVGSEAAQPQIME------AGTYNYGFHVKLPKN-CPGNFEGGHGHIRYTLQVLIHSS 137
            ||...|..:|.|.......|      :|.:.|.|..:||:. ...:|||.||.:||.::..:|  
  Rat    81 YFNHKDILIGHERDDDNCEEGFSTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELH-- 143

  Fly   138 ADRP--LEVLHVRQLQIF------------PQNSLSQETRSCEIQIYEQTPRLRFWM---KPLHL 185
              ||  |.|...::..:|            ||....::|..|             |.   .|:.|
  Rat   144 --RPWLLPVKLKKEFTVFEHIDIN
TPSLLSPQAGTKEKTLCC-------------WFCTSGPISL 193

  Fly   186 QLQIPRQGYSPGAGISVHLKLHN--PEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVL 248
            ..:|.|:||:||..|.:..::.|  ...:..:.|:|     .|...:.|.|.|.:     :|.|.
  Rat   194 SAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIY-----QTQAFYAKGKMKEV-----KQLVA 248

  Fly   249 SSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLIAARMPV 313
            :.|.|  :|..|:.:.:.. .:|::|..:.  ::..|:.:::.|.:.|.|.......|:.: :|:
  Rat   249 NLRGE--SLSSGKTETWDG-KLLKIPPVSP--SILDCSIIRVEYSLMVYVDIPGAMDLLLS-LPL 307

  Fly   314 IIG------------NVTPPCP------GKLLMQEPIDGTAPEPTPPVETASTLIPNFSISTTSL 360
            :||            :|:..|.      |..|.:.|   .||.....|.|......|  ::..|.
  Rat   308 VIGTIPLHPFGSRTSSVSSQCSMNMNWLGLSLPERP---EAPPSYAEVVTEEQRRNN--LAPVSA 367

  Fly   361 ASNFREAEFMVATNLNKTNKHYLSG------EQLDFRPRYVYYEMDQT--QSEE 406
            ..:|..|               |.|      ::..|.|..:|.|:|..  ||.|
  Rat   368 CDDFERA---------------LQGPLFAYIQEFRFLPPPLYSEIDPNPDQSSE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 35/132 (27%)
Arrestin_C 179..322 CDD:214976 34/159 (21%)
Arrdc3NP_001007798.1 Arrestin_N 22..165 CDD:395268 40/152 (26%)
Arrestin_C 187..314 CDD:214976 32/142 (23%)
PPxY motif 1. /evidence=ECO:0000305 346..349 1/2 (50%)
PPxY motif 2. /evidence=ECO:0000305 391..394 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.