DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Arrdc4

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001380690.1 Gene:Arrdc4 / 293019 RGDID:1311763 Length:415 Species:Rattus norvegicus


Alignment Length:436 Identity:96/436 - (22%)
Similarity:169/436 - (38%) Gaps:131/436 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQSLDF 74
            |..:|.|.:|:||.|||.|..:|...::.:.|||.|.|::||......:.......|.....:::
  Rat    23 DESKGCYSSGETVAGHVLLEAAEPVTLRGLRLEAQGRATSAWGPSAGARVCIGGASPAASSEVEY 87

  Fly    75 -DYRVDYFAKIDYFVGSEAAQPQ---IMEAGTYNYGFHVKLPKN-CPGNFEGGHGHIRYTLQVLI 134
             :.|:...         ||...:   :::.|.:.:.|..:||.. ...:|.|.:|.|:|.::.::
  Rat    88 LNLRLSLL---------EAPAGEGVTLLQPGKHEFPFRFQLPSEPLATSFTGKYGSIQYCVRAVL 143

  Fly   135 HSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQ---------TPRLR----------FWM 180
                :||         |: |..|:.:     |:|:...         ||.|:          |..
  Rat   144 ----ERP---------QV-PDQSVRR-----ELQVVSHVDVN
TPPLLTPMLKTQEKMVGCWLFTS 189

  Fly   181 KPLHLQLQIPRQGYSPGAGISVHLKLHN-PEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVER 244
            .|:.|.::|.|:||..|..|.::.::.| ..:|.:.:|  ::.|..||:|..|.|          
  Rat   190 GPVSLSVKIERKGYCNGEAIPIYAEIENCSSRLVVPKA--AIFQTQTYLASGKTK---------- 242

  Fly   245 QTVLSSRHELHNLPRGELQNFQHL----------HMLQVPQTAATLTVAGCACLQLNYEVEVLVT 299
             ||   ||.:.|: ||     .|:          .||::|  ..|.::..|..::::|.:.|.:.
  Rat   243 -TV---RHMVANV-RG-----NHIGSGSTDTWNGKMLKIP--PVTPSILDCCIIRVDYSLAVYIH 295

  Fly   300 TQQEKRLIAARMPVIIGNVTPPCPGKLLMQEPIDGTAPEPTPPVETASTLIPNFSISTTSLASNF 364
            ....|:|: ..:|::||.:            |..|                  |....:|:||.|
  Rat   296 IPGAKKLM-LELPLVIGTI------------PYSG------------------FGRRNSSMASQF 329

  Fly   365 REAEFMVATNLNKTNKHYLSGEQLDFRPRYVYYEMDQTQSEEVKSH 410
            ......:|..|         .||.:..|.|.    |....||...|
  Rat   330 SMDMCWLALAL---------PEQPEAPPNYA----DVVSEEEFSRH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 31/135 (23%)
Arrestin_C 179..322 CDD:214976 37/153 (24%)
Arrdc4NP_001380690.1 Arrestin_N 19..166 CDD:395268 38/170 (22%)
Arrestin_C 188..315 CDD:214976 37/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.