DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and ZK938.11

DIOPT Version :10

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001317870.1 Gene:ZK938.11 / 28661663 WormBaseID:WBGene00270290 Length:129 Species:Caenorhabditis elegans


Alignment Length:139 Identity:28/139 - (20%)
Similarity:49/139 - (35%) Gaps:57/139 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KNEQPVVVQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHI 126
            ||:.||.:....|::::...:::.|..                                   |||
 Worm    27 KNKLPVELLEKSFEFQIPTGSRLTYKA-----------------------------------GHI 56

  Fly   127 RYTLQVLIHSSADRP--------LEVLHVRQLQI----FPQN-SLSQETRSCEIQIYEQTPRLRF 178
            :||:.:    ..|||        .||:..|:|.:    |.:| ::|.:......|:...|.||  
 Worm    57 KYTMSL----EVDRPWKTNLKVKKEVIVARKLDVDEVYFTENKTVSNKPAIGVFQMGSSTSRL-- 115

  Fly   179 WMKPLHLQL 187
               |.|:.|
 Worm   116 ---PPHVLL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:451447 12/78 (15%)
Arrestin_C 179..318 CDD:460676 3/9 (33%)
ZK938.11NP_001317870.1 Arrestin_N <11..86 CDD:451447 18/97 (19%)

Return to query results.
Submit another query.