DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and SPBC839.02

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_595242.1 Gene:SPBC839.02 / 2541205 PomBaseID:SPBC839.02 Length:530 Species:Schizosaccharomyces pombe


Alignment Length:436 Identity:80/436 - (18%)
Similarity:156/436 - (35%) Gaps:112/436 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RCEIQLDNPRGVYRAGDT-----------VNGHVYLTLSERALIKAICLEANGYASTAWQQ--PQ 55
            |..|.|..| .:|..|.|           :.|.:.:.:.:...:|.|.|...|.:.|.|.:  |.
pombe    71 RVAIALAEP-VLYLPGATSSEIQSEHSAVLRGSLCIQIYKPVKLKKIQLSFKGKSRTEWPEGIPP 134

  Fly    56 K------------------HKNQKKNEQPVVVQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEA-- 100
            |                  |..||.:|.         .:...::..:.::..: |..|:.||.  
pombe   135 KLFDTYEENSIMNHCWVFFHSEQKVDEN---------SHGAVWYKVLPHYADT-AHYPRSMECFY 189

  Fly   101 -GTYNYGFHVKLPKNC--PGNFEGGHGHIRYTLQVLI--------HSSADRPLEVLHVRQLQIFP 154
             |.|.|.|  :||.:|  |.:.:...|.:.|.|:.|:        .|:...|:|::         
pombe   190 PGEYVYNF--ELPISCTYPESIQTDMGRVYYFLETLVDRSSTFSGKSTGRIPIELI--------- 243

  Fly   155 QNSLSQETRS-CEIQIYEQTPRL--RFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLRE 216
                    || |...:....|.|  :.|...||.::|:..:....|..:.|:.|.....::...:
pombe   244 --------RSPCSTSVATSEPILVSKSWEDRLHYEVQVGEKCVVMGQVVPVNFKFTLLGEVKFHK 300

  Fly   217 AVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRHELHNLPRGE--LQNFQHLHMLQVPQTAAT 279
            ....|::...|....::..::.:|   ||.:|..|    :.|:.:  |.:::.:.. .|.:.:..
pombe   301 LRLFLMERRYYYCRQRSVRRKEKT---RQLLLYER----SAPKNQCLLSDWKQVRP-DVYELSDQ 357

  Fly   280 LTVAGCACLQLNY--------EVEVLVTTQQEKRLIAARMPVIIGN-----VTPPCPGKLLMQEP 331
            :.:.||..:..|.        .:::..|.:...|......|.::|:     :....|.:||....
pombe   358 VRIPGCHDMAANIVHFDTTYPNIKITHTVRTVLRFSCENSPELMGSAKYLEIYIDSPVRLLSCRC 422

  Fly   332 IDGTAPEPTPPVETASTLIPNFSISTTSLASNFREAEFMVATNLNK 377
            .||            ||::|.:.....|...||...:..:...:|:
pombe   423 SDG------------STMLPAYCPIIPSSEVNFCSIDNRIIAGMNR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 36/179 (20%)
Arrestin_C 179..322 CDD:214976 24/157 (15%)
SPBC839.02NP_595242.1 Arrestin_N 101..227 CDD:304627 29/137 (21%)
Arrestin_C 263..422 CDD:214976 27/166 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.