DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and SPBC18H10.20c

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_595744.1 Gene:SPBC18H10.20c / 2540833 PomBaseID:SPBC18H10.20c Length:361 Species:Schizosaccharomyces pombe


Alignment Length:323 Identity:59/323 - (18%)
Similarity:110/323 - (34%) Gaps:98/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PQNSLSQETRSCEIQIYEQTPRLRFWMKPLH---------LQLQIPRQGYSPGAGISVH-LKLHN 208
            |:::..::...|.:.|..::|.|.|...|..         |:|.|..|.:     |.|| |||..
pombe     8 PRSTTPKDPARCTLDIRMESPPLVFLGSPETSSGALASGILKLTILHQPF-----IKVHTLKLQL 67

  Fly   209 PEKLT-LREAV---------------YSLVQISTY-----------------VAHLKNKPKRLET 240
            .:::| |..|:               :.|...:||                 .|.:.|:..:||.
pombe    68 IKRITVLHPAISHCSACAGSKEVLQTWDLAANTTYRPGTQHWPFSWLFPGSLPASVSNRYIKLEY 132

  Fly   241 KVERQT--------VLSSRHELHNLP----RGELQNFQHLHMLQVPQT--------AATLTVAGC 285
            .:|...        :..|:.|:...|    |..:.:...:|....|.|        .:||...|.
pombe   133 YLEATLCYGTPEGGISPSKPEVLKFPLQLKRAAIPSPDTIHKRIFPPTNLVANITLPSTLHPHGA 197

  Fly   286 ACLQL-----------NYEVEVLVTTQQEKRLIAARMPVIIGNVTPPCP--GKLLMQEPIDGTAP 337
            |.:::           ::::..:....:|....:.:          ||.  ..|:...||:....
pombe   198 ALMEVTMTGFAQNDGNDWKINRVTWRLEEHMQFSCQ----------PCERHRDLVKPRPIEEKRI 252

  Fly   338 EPTPPVETASTLIPN-----FSISTTSLASNFREAEFMVATNLNKTNKHYLSGEQLDFRPRYV 395
            ..|..:::....|.|     ..|:|:||.....:.|.....:|..:  |:|..|.:..|.:.|
pombe   253 LSTQDLQSGWKFIDNQMFLSTQINTSSLREPSCDVEIPAPFSLKVS--HHLIFETIVNRKKNV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627
Arrestin_C 179..322 CDD:214976 34/216 (16%)
SPBC18H10.20cNP_595744.1 LDB19 63..242 CDD:193475 28/188 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.