DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and SPBC2D10.04

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_596223.1 Gene:SPBC2D10.04 / 2540410 PomBaseID:SPBC2D10.04 Length:658 Species:Schizosaccharomyces pombe


Alignment Length:414 Identity:84/414 - (20%)
Similarity:143/414 - (34%) Gaps:117/414 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQ 70
            |.|::||.       .:.|.:.|.:::.|.|:.|.|...|.:.|.|.:....|.....|..|::.
pombe   167 ECQIENPA-------LLRGALVLRVAKPANIRGISLSFTGRSRTEWPEGIPVKGHDTYEDKVIIS 224

  Fly    71 ---------SLDFDYRVDYFAKIDYFVGSEAAQP----------QIMEAGTYNYGFHVKLPKNCP 116
                     ..|.| ...:.|.:...||.:...|          .:...|.|.|.|.:.:|...|
pombe   225 HNWKFYEPTMKDAD-APQHGADVARLVGEQLPLPSSAAASLRGYSVFAPGEYTYNFDLAIPNCFP 288

  Fly   117 GNFEGGHGHIRYTLQVLI--------HSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQT 173
            .:.|...|.:||.|:..:        :.:...|::::....    |.:..|.|..:..       
pombe   289 ESVEAKMGWVRYFLEATVERFGTFKSNLNGRTPVQLVRTPS----PASLSSSELINIS------- 342

  Fly   174 PRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRL 238
               |.|.:.||.:||:..:.:..|..:.:..:....:|:.|.:...|:|:.|.|... ..|..|:
pombe   343 ---RDWDERLHYELQVSGKSFRLGEVVPITFRFLLLDKVRLYKLSISVVESSEYWCR-SRKFHRV 403

  Fly   239 ETKVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLT-------VAGCACL-------- 288
            :.|  |:.:|:.|...|       ||..:|  .:.|.....|:       ||...||        
pombe   404 DPK--RRVLLAERSAKH-------QNTDNL--FETPDEGDGLSSAVFNFNVALPTCLVKERDRLT 457

  Fly   289 --------QLNYEVEVLV------TTQQEKRL---IAARMPVII--------------------- 315
                    ::.:.::.|:      |...|||.   |....||.|                     
pombe   458 FDTTYKYIKVRHRLKALLVLSIENTENPEKRKYFEINIETPVRILSCRCVKDSTLLPPYESSSQG 522

  Fly   316 -GNVTPPCPGKLLMQ--EPIDGTA 336
             ..|..|||.:|...  ||.:.||
pombe   523 DNQVLLPCPCRLATTHVEPTEVTA 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 33/161 (20%)
Arrestin_C 179..322 CDD:214976 38/196 (19%)
SPBC2D10.04NP_596223.1 Arrestin_N 178..308 CDD:304627 29/130 (22%)
Arrestin_C 345..506 CDD:214976 37/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.