DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and SPCC584.15c

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_588220.1 Gene:SPCC584.15c / 2539284 PomBaseID:SPCC584.15c Length:594 Species:Schizosaccharomyces pombe


Alignment Length:465 Identity:96/465 - (20%)
Similarity:168/465 - (36%) Gaps:117/465 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HRCEIQLDNPRGVYRAG-----------DT---VNGHVYLTLSERALIKAICLEANGYASTAWQQ 53
            |:..::|...| :|.|.           ||   ::|.|.|::|....:|.|.|..:|.:...|..
pombe     9 HKSPVKLFEVR-LYNAEANVIVLYGNSMDTSARLSGIVVLSVSSPIRVKNIKLRLSGRSFVCWAD 72

  Fly    54 PQKHKNQKKNEQPVVVQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGN 118
            ..:|.:.....:..|||.||..:        .:...:|:|  ::::.|.|.|.|:.:||.:.|.:
pombe    73 ESRHASPGNRIRRQVVQILDKSW--------SFLAPNESA--KVIDQGNYEYPFYYELPPDIPDS 127

  Fly   119 FEGGHG-HIRYTLQVLIHSSADRPLEV---LHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFW 179
            .||..| ||.|||...:..:...|..:   |..|.::..|.|||         .:.........|
pombe   128 IEGIPGCHIIYTLTASLERATQPPTNLETALQFRVIRTIPPNSL---------DLMHSVSVSDIW 183

  Fly   180 MKPLHLQLQIPRQGYSPGAGISVHLKLHNPEK--------LTLREAVYSLVQISTYVAHLKNKPK 236
            ...::.:..||.:.|:.|:.|.|::.|:...|        |.|:|.....:....|.:..:.:.|
pombe   184 PLKVNYETSIPSKVYAIGSEIPVNITLYPLLKGLDVGKVTLVLKEYCTLFITSKAYSSTCRKEFK 248

  Fly   237 RLETKVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGC--ACLQLNYEVEVLVT 299
            |...|          ..:..||..: ..:|...|:::|.:....| ..|  .|:::::::.:.::
pombe   249 RALVK----------KTIPGLPMVD-DYWQDQIMVKIPDSLGECT-QDCDLNCIRVHHKLRLSIS 301

  Fly   300 ----------TQQEKRLIAARMPVIIG------------------NVTPPCPGKLLMQEPIDG-- 334
                      .:....|.....||:.|                  |:.|.. .|.:.....||  
pombe   302 LLNPDGHVSELRNSLPLSLVISPVMFGARPTEGVFTGDHNSYVNENILPSY-DKHVFDVLWDGIP 365

  Fly   335 ----------TAPE----------PTPPVETASTLIPNFSISTTSLASNFREAEFMVATNLNKTN 379
                      |.|.          |..||...|..:|......:|.||| ..|.|...     ::
pombe   366 SENPQLQSGFTTPNLSRRNSSDFGPNSPVNIHSNPVPISGQQPSSPASN-SNANFFFG-----SS 424

  Fly   380 KHYLSGEQLD 389
            ...:|.||.|
pombe   425 PQSMSSEQTD 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 38/150 (25%)
Arrestin_C 179..322 CDD:214976 30/180 (17%)
SPCC584.15cNP_588220.1 Arrestin_N 41..166 CDD:304627 35/134 (26%)
Arrestin_C 183..324 CDD:214976 25/152 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3293
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto101487
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.