DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Arrdc1

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_006497901.1 Gene:Arrdc1 / 215705 MGIID:2446136 Length:436 Species:Mus musculus


Alignment Length:388 Identity:90/388 - (23%)
Similarity:150/388 - (38%) Gaps:93/388 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAI---CLEANGYASTAWQQPQKHKNQKKNEQPV 67
            ||:|...|.||..|:.:.|.|:|.|......:||   |:.:.|.::            |.|:...
Mouse     8 EIRLSQGRVVYGPGEPLAGTVHLRLGAPLPFRAIRVTCMGSCGVST------------KANDGAW 60

  Fly    68 VVQSLDFDYRVDYFAKIDYFVGS-EAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQ 131
            ||:.             .||..| ..|....:.||.:|:.|...||...|.:|||..|.|.:.  
Mouse    61 VVEE-------------SYFNSSLSLADKGSLPAGEHNFPFQFLLPATAPTSFEGPFGKIVHQ-- 110

  Fly   132 VLIHSSADRP--------------LEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWMKP 182
              :.:|.|.|              |..|::..:....|.:::..|:....::.:        ...
Mouse   111 --VRASIDTPRFSKDHKCSLVFYILSPLNLN
SIPDIEQPNVASTTKKFSYKLVK--------TGN 165

  Fly   183 LHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTV 247
            :.|......:||..|..:.:...:.|.........|.||:|..:|.|.......|...:||...|
Mouse   166 VVLTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQKVSYKAKRWIYDVRTIAEVEGTGV 230

  Fly   248 LSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLIAARMP 312
            .:.|       |.:.|  :.:.:..:||:|    :.||:.:.::|.::|.:...:    ....:|
Mouse   231 KAWR-------RAQWQ--EQILVPALPQSA----LPGCSLIHIDYYLQVSMKAPE----ATVTLP 278

  Fly   313 VIIGNV----TP--PCPGKLLMQEPIDGT----APEPTPPVETASTLI--PNF----SISTTS 359
            :.:||:    ||  ||||:    |...||    .|. .||.|.|..:.  |:|    |:||.|
Mouse   279 LFVGNIAVNQTPLSPCPGR----ESSPGTLSLVVPS-APPQEEAEAVASGPHFSDPVSLSTKS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 37/138 (27%)
Arrestin_C 179..322 CDD:214976 30/148 (20%)
Arrdc1XP_006497901.1 Arrestin_N 7..139 CDD:389964 40/159 (25%)
Arrestin_C 162..284 CDD:367164 27/146 (18%)
PHA03247 <289..429 CDD:223021 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.