DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-15

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001254970.1 Gene:arrd-15 / 191372 WormBaseID:WBGene00014033 Length:374 Species:Caenorhabditis elegans


Alignment Length:293 Identity:64/293 - (21%)
Similarity:113/293 - (38%) Gaps:64/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQLDNPRGVYRAGDTVNGHVYLTLSE-RALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQ 70
            |.|..||.:  ||:..|..|.|..|: ..::.:.|.|..|...|.|......|            
 Worm    40 IVLAEPRCM--AGEFFNAKVLLDSSDPDTVVHSFCAEIKGIGRTGWVNIHTDK------------ 90

  Fly    71 SLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGT------YNYGFHVKLPKNCPGNFEGGHGHIRYT 129
              .|:....|   ||       .|.|:.::||      :.:...:::|.|||.::|...|.|||.
 Worm    91 --IFETEKTY---ID-------TQVQLCDSGTCLPVGKHQFPVQIRIPLNCPSSYESQFGSIRYQ 143

  Fly   130 LQVLIHSSADR-------PLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWMKPLHLQL 187
            ::|.:.:|.|:       ||.:|........|.|::|......|:.....|  |.|..  :.|.:
 Worm   144 MKVELRASTDQASCSEVFPLVILTRSFFDDVPLNAMSPIDFKDEVDFTCCT--LPFGC--VSLNM 204

  Fly   188 QIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLK----NKPKRLETKVERQTVL 248
            .:.|..:..|..|...:.::|..:..|:|....|:..:.:.|..:    |:.|..|..:|.    
 Worm   205 SLTRTAFRIGESIEAVVTINNRTRKGLKEVALQLIMKTQFEARSRYEHVNEKKLAEQLIEM---- 265

  Fly   249 SSRHELHNLPRGELQNFQHLH----MLQVPQTA 277
                    :|.|.:::...:.    :|::|..|
 Worm   266 --------VPLGAVKSRCRMEFEKCLLRIPDAA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 36/147 (24%)
Arrestin_C 179..322 CDD:214976 18/107 (17%)
arrd-15NP_001254970.1 Arrestin_N 49..148 CDD:304627 30/122 (25%)
Arrestin_C 198..330 CDD:280848 18/107 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.