DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-16

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_499629.2 Gene:arrd-16 / 190071 WormBaseID:WBGene00013043 Length:399 Species:Caenorhabditis elegans


Alignment Length:429 Identity:102/429 - (23%)
Similarity:174/429 - (40%) Gaps:94/429 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHRCEIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQ 65
            |.....:.|.|...:|..|.|:.|:|...|.|...:|||.:.|.|.|:|.|...:..|:.....:
 Worm     1 MPFHLALGLSNCEQIYEPGGTIEGYVTFDLRESVKVKAIRISAEGLATTKWLLSESSKSSHGRSR 65

  Fly    66 PVVVQSLDFDYRVDYFAKIDY-------FVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGH 123
                       .|.|.||:.|       :..||......:..|.:.|.|..::|...|.:|||.|
 Worm    66 -----------EVSYSAKVTYLDEEQMVWKPSEGHSKSSVFPGIHVYPFKFQIPIGVPPSFEGDH 119

  Fly   124 GHIRYTLQVLIHSSADRPLEVLH--VRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWM---KPL 183
            |:|||.::    ::.:||.:...  .|.|.|.|...|::|..:.|.....::.::.|::   ..:
 Worm   120 GNIRYHMK----ATVERPWKTNRSVTRYLTILPPKDLNKEVLASEETSSWKSKKVGFFLFRYGKV 180

  Fly   184 HLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAH---------------LKN 233
            :||::||::||.||..||:...:.|.....:.:....|:|...::|:               |..
 Worm   181 NLQIRIPKKGYVPGETISIETNIDNMSSRPILKTECYLIQQCRFLAYRYGISGPTDGRRASSLSE 245

  Fly   234 KPKRLETKVERQTVLSSRHELHNLPRGELQNFQHLH----MLQVPQTAATLTVAGCACLQLNYEV 294
            ..:.|..|.:...::|..||:|..||.|       |    .|::|.|..|.   ....:.:.|.|
 Worm   246 NDRYLSRKRDEIKIVSVIHEMHIEPRTE-------HKAKMRLKIPCTCPTF---DSTLIHVEYFV 300

  Fly   295 EVLVTTQ-QEKRLIAARMPVIIGNVTPPCPGKLLMQEPIDGTAPEPTPPVETASTLIPNFSISTT 358
            .|.:..: :.:..:.|..|:|||:       |.|..|.:|...|                     
 Worm   301 VVKLHVKCRMRNTVKAECPIIIGS-------KPLADEHVDPRTP--------------------- 337

  Fly   359 SLASNFREAEFMVATNLNKTNKHYLSGEQLDFRPRYVYY 397
                .::|    |||....|::..:|.:: ...|:||||
 Worm   338 ----TYQE----VATFSALTHRSMMSVDE-KLTPKYVYY 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 38/142 (27%)
Arrestin_C 179..322 CDD:214976 37/165 (22%)
arrd-16NP_499629.2 Arrestin_N 9..153 CDD:334019 44/158 (28%)
Arrestin_C 178..327 CDD:214976 38/165 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I8403
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28585
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.