DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-22

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_503955.1 Gene:arrd-22 / 188642 WormBaseID:WBGene00020612 Length:456 Species:Caenorhabditis elegans


Alignment Length:428 Identity:93/428 - (21%)
Similarity:171/428 - (39%) Gaps:86/428 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQ 70
            ::..|.|..|:..|..::|.|.||..::...:|:.::..|.|.|:|   :.::|..|        
 Worm     8 QVIFDQPDEVFLPGQPISGRVVLTTKKKLSARAVNIKIVGLAHTSW---KNYENSCK-------- 61

  Fly    71 SLDF----DYR---VDYFAKIDYFVGSE-----AAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGH 123
             |.|    .||   |.|.|.:.|...::     ...|:.:.||.|.:.|...||.|.|.:|||.:
 Worm    62 -LSFHRIVSYRPHGVYYSANVKYLDYTQLLWTCGEGPKELNAGEYAWPFSYTLPLNIPPSFEGKY 125

  Fly   124 GHIRYTLQVLIHSSADRPLEV---------------LHVRQLQIFPQNSLSQETRSCEIQIYEQT 173
            |::|||::|    ..|||..|               |:|....:.|.|:.:.|...|        
 Worm   126 GYLRYTVKV----EVDRPWRVDKAKKMCITVSPLLDLNVIPHSLTPINTQASENLGC-------- 178

  Fly   174 PRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAH-------- 230
              ..|....|.:.:.||:.|:.||..:.:::.|.|....|.::....::|...:..:        
 Worm   179 --CCFKNGFLEMNVNIPKTGFVPGETVPLNIHLINHSSSTAKKIEAKILQQCKFTGYKDGATYNY 241

  Fly   231 -----LKNKPKRL--ETKVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCA-C 287
                 :..|.:|:  :||    ||:....:|....:.|     |..:|::...:.|.|:...: .
 Worm   242 GGDENMSEKAQRIMFDTK----TVVRESQKLVVAAKNE-----HKFVLELRIPSVTPTINQFSPV 297

  Fly   288 LQLNYEVEVLV-TTQQEKRLIAARMPVIIGNV-TPPC-PGKLLMQEPIDGTAPEPTPPVETASTL 349
            :.:.|.:::.| |:......:.....:::|:| ...| |.....|:|  ...|....|:......
 Worm   298 VTVEYLIQLKVDTSAMSHSEVRCETSILLGSVPIRQCLPPSYYQQDP--SVLPSKPTPIGEGVAP 360

  Fly   350 IPNF-SISTTSLASNFREAEFMVA--TNLNKTNKHYLS 384
            .|.: |:..|..:....:|.:.:.  .|:|..|..|.|
 Worm   361 PPGYGSLPMTDDSEKGTDAPYPLGLYPNVNDVNLPYPS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 41/146 (28%)
Arrestin_C 179..322 CDD:214976 27/160 (17%)
arrd-22NP_503955.1 Arrestin_N 7..159 CDD:334019 44/166 (27%)
Arrestin_C 182..330 CDD:214976 26/156 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.