DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-23

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_508830.3 Gene:arrd-23 / 188239 WormBaseID:WBGene00020323 Length:444 Species:Caenorhabditis elegans


Alignment Length:317 Identity:62/317 - (19%)
Similarity:125/317 - (39%) Gaps:48/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CEIQLDNPRGVYRAGDTVNGHVYLTLSERAL-IKAICLEANGYASTAWQQPQKHKNQKKNEQPVV 68
            |.::|......|..|||:.|.:.|.:||.:: |.::.:..:||.          |...|.::..:
 Worm    16 CMLELSRKDACYNWGDTIQGKLNLKISEGSIEITSLRILFHGYG----------KINCKGKKDEL 70

  Fly    69 VQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQVL 133
            :|.     .:.|..|.    .:..:||.::....|:......||...|.:.....|||:|.:|..
 Worm    71 LQE-----NMTYMKKF----SNAISQPIVVSQQEYSIPIEETLPDQLPTSVYSPKGHIQYVIQCT 126

  Fly   134 IH--SSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWMKPLHLQLQIPRQGYSP 196
            :.  ::|..|..|..||.:.:.....|::.:::              |.:|   :.:..::.:..
 Worm   127 LEYKTAAGTPSIVKAVRGITVIESLDLNKISKT--------------WFEP---KTEFEQRKFGW 174

  Fly   197 GAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRH-ELHNLPRG 260
            .|....|::||    ||...:.:...:...::..::||..|   ::|:.:|...|: ...|....
 Worm   175 FACTGGHIRLH----LTFERSAFVCGEAIPFIGKIENKSDR---RIEKVSVCLMRNTRFGNDVED 232

  Fly   261 ELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLIAARMPVIIGN 317
            :::|....|.|......|.....||. .:::.:|.:..|.......|..|...:.||
 Worm   233 DVENATVDHHLIQEDLMAMYIEEGCV-NKIDKKVHIPCTAPSTPLPILFRSGQLDGN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 30/138 (22%)
Arrestin_C 179..322 CDD:214976 27/140 (19%)
arrd-23NP_508830.3 Arrestin_C 180..353 CDD:214976 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.