DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-3

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_496010.2 Gene:arrd-3 / 187498 WormBaseID:WBGene00006429 Length:287 Species:Caenorhabditis elegans


Alignment Length:324 Identity:56/324 - (17%)
Similarity:120/324 - (37%) Gaps:71/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQS 71
            |.||.....||..:.|.|:|.:...:....:.:.:...||..|:|::.|:..:.......|.|:|
 Worm     6 IVLDRDTCKYRPEECVTGNVVIINRKELKARTLRVYIKGYQKTSWKEIQQKPSLVVRSNGVNVKS 70

  Fly    72 L--------DFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRY 128
            .        :..|...|....::...::..:|     ||:.:.|..|||.:||            
 Worm    71 TIKLKSHGENIQYIHLYMTLWNFTSDTDCIKP-----GTHKFPFSFKLPADCP------------ 118

  Fly   129 TLQVLIHSSADRPLEVLHV-----RQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWMKPLHLQLQ 188
               .::.::...|.::..:     :.:.:|.::.:                        :.::..
 Worm   119 ---P
IVPNATYIPKDLQQINGAVSKNIGVFFKSGI------------------------VSVKTS 156

  Fly   189 IPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRHE 253
            .|::....|..|.:.|.:.|....|:||....:.:|:.:.|       :.:.|:.||..:..|..
 Worm   157 FPQRVLITGEVIPLTLLIDNKSTCTVREVGVRIFRIARFYA-------KDQEKMTRQRKIMIRKS 214

  Fly   254 LHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEV-LVTTQQEKRLIAARMPVIIG 316
            ::..|..|.|......:.:..||..:      ..:::.|.:.| :.||...:..:.:...||||
 Worm   215 INVEPNTEQQELIEFKVHETVQTFES------DLIEVKYLMHVDVFTTSAFRGTLNSVFSVIIG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 27/141 (19%)
Arrestin_C 179..322 CDD:214976 27/139 (19%)
arrd-3NP_496010.2 Arrestin_N 4..>119 CDD:389964 27/132 (20%)
Arrestin_C 147..275 CDD:214976 27/163 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.