DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-6

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001254290.1 Gene:arrd-6 / 185541 WormBaseID:WBGene00009579 Length:469 Species:Caenorhabditis elegans


Alignment Length:420 Identity:83/420 - (19%)
Similarity:155/420 - (36%) Gaps:92/420 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQ 70
            :|:|:  :.||.||:|::|.|.|..:|...|:.|.:...|......:..:..:.:...:...|:.
 Worm    35 DIRLN--KDVYYAGETISGSVLLENTENIKIRGIRVLLRGKVHATLKVVKSGERRTLKDDQYVLD 97

  Fly    71 SLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPK-NCPGNFEGGHGHIRYTLQVLI 134
            .....:..|   |.|     |:....|:..|.:.:.|:..||: :.|.:.|..|..|||..:|:|
 Worm    98 EKQLLWGKD---KSD-----ESDSVPILARGVHQFSFNFDLPQSSLPCSLESRHCTIRYYFKVII 154

  Fly   135 ---HSSADRPLEVL-----HVRQLQ---IFPQNSLSQETRSCEIQIYEQTPRLRFW---MKPLHL 185
               ::|:.:.::..     |:..::   :.|.::..::...|             |   ...|.|
 Worm   155 DIPYASSPQGIKYFTIIGPH
IDSMEEKYLSPLSAQDRKVNCC-------------WCCQRGALAL 206

  Fly   186 QLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSS 250
            ::.:.|..|..|..|.|..::.|.:. |.:..|..|||   :|.....|....|.|:....|.. 
 Worm   207 RIILERTAYVCGENIRVRAQIENRQS-TAQSLVIRLVQ---HVEVFVEKGLLGENKMMSCVVFE- 266

  Fly   251 RHELHNLP------RGELQNF--QHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLI 307
                |..|      :|:..:.  |.:.:..||.|    .|..|..:|:.|.:.|.:..::....:
 Worm   267 ----HKSPAIAANSQGKYDSTLEQPIRLPVVPPT----LVGVCRLIQIYYALRVCMEDEKGNECL 323

  Fly   308 AARMPVIIGNVTPPCPGKLLMQEPIDGTAPEPTPPVETASTLIPNFSISTTSLASNFREAEFMVA 372
            ....|:.:..:....|.             .|.|||:             ....||..|....|:
 Worm   324 HIDFPLTVATIPYRIPN-------------APPPPVD-------------YDFCSNHVEGGKYVS 362

  Fly   373 TNLNKTNKHYLSGEQLD-------FRPRYV 395
            ........:...||:::       :||.||
 Worm   363 PEFRLGQVYDGEGEEINKEEEIVLYRPVYV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 33/138 (24%)
Arrestin_C 179..322 CDD:214976 32/153 (21%)
arrd-6NP_001254290.1 Arrestin_N 34..174 CDD:278754 33/148 (22%)
Arrestin_C 201..336 CDD:214976 31/147 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28585
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.