DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and ttm-2

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_494855.1 Gene:ttm-2 / 184995 WormBaseID:WBGene00017840 Length:358 Species:Caenorhabditis elegans


Alignment Length:358 Identity:72/358 - (20%)
Similarity:142/358 - (39%) Gaps:69/358 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RCEIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPV- 67
            |..:.||.|  .|:.|.|:.|||  .......::..|:|...:....:.| |...|..:|..|: 
 Worm     6 RFTVLLDRP--FYQPGQTIQGHV--VCEPHHPLEIDCVEGRLHGEIQYFQ-QLPPNHNRNGSPLP 65

  Fly    68 -------------------VVQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPK 113
                               |.:.|..|...|......:...|.:|....:......:...::||.
 Worm    66 PSKTRVLIDEKAQLWKYQTVSEMLGLDVFYDENQNRHFSSESASASSSSLFTTAATFPIQIELPH 130

  Fly   114 NCPGNF--EGGHGHIRYTLQVLIH------SSADRPLEVLHVRQL--QIFPQNSLSQETRSCEIQ 168
            ..|.:|  .|....||:||::.::      :|.:..|.||:...:  |:.|:....|:|.:    
 Worm   131 FAPPSFYCPGSPVSIRFTLEIQLYNQGFKIASHEENLVVLNYESIKRQVTPKPVNFQKTFN---- 191

  Fly   169 IYEQTPRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKN 233
                .|:.|    .:.|::.:|...::..|.:...:.:.|..|.:|:   |..:.|...::.|..
 Worm   192 ----FPKER----SISLEMLLPTDVFTTTARLENCITICNRWKQSLK---YVHLNIVRRISALNQ 245

  Fly   234 KPKRLET-KVERQTV-LSSRHELHNLPRGELQNFQ----------HLHMLQVPQTAATLTVA-GC 285
            ..:.::| |::...| |.|:.:   :..||..:|:          ::|:..:.:|..:|.|. |.
 Worm   246 NNEVIDTVKIDTTGVGLPSKTK---IAVGETYSFRPTFNVPALPPNIHVNGLFKTEYSLKVTIGR 307

  Fly   286 A--CLQLNYEVEV-LVTTQQEKRLIAARMPVII 315
            |  .:..:|||.: :||..|..|....:..:::
 Worm   308 AHNFVLASYEVPITIVTMDQSSRRSMQKEDILV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 32/163 (20%)
Arrestin_C 179..322 CDD:214976 30/153 (20%)
ttm-2NP_494855.1 Arrestin_N 7..149 CDD:389964 29/146 (20%)
Arrestin_C <231..326 CDD:383149 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.