DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-28

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_509710.2 Gene:arrd-28 / 184759 WormBaseID:WBGene00009000 Length:650 Species:Caenorhabditis elegans


Alignment Length:274 Identity:52/274 - (18%)
Similarity:97/274 - (35%) Gaps:88/274 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQVLIHSSADRPLEVLHVRQLQIFPQNSLSQE 161
            ::..|.:|:.|.:....:            :|...:|..:..|....::|...:.: |:|...|:
 Worm   397 LLSPGEHNFRFQLPFADS------------QYDTSILPPTLGDEIKYMIHASTVSL-PKNFFQQQ 448

  Fly   162 TRSCEIQIYEQTPRLRF---WMKPLHLQLQIPRQGYSP------GAGISVHLKLHNPEKLTLR-E 216
               ||:.:.      ||   |.|          :.|.|      ||     .|:|..::...| :
 Worm   449 ---CELLVD------RFIDTWAK----------EAYKPPYTEEYGA-----TKIHLSQRCFKRGK 489

  Fly   217 AVYSLVQIS--TYVAHLKNKPKRL--------ETKVERQTVLSSRHELHNLPRGELQNFQHLHML 271
            .|...:|.|  .||.....:.|||        |:...::.|......:|..        .|:|::
 Worm   490 HVIVALQGSEPRYVKGTLVQKKRLRVPNVKLDESYCSQRNVRIFEENIHRK--------DHIHVM 546

  Fly   272 QVP-QTAATLTVAGCACLQLNYEVEVLVT-----TQQEKRLIAARMPVIIG----NVTPPCPGK- 325
            .:| ....::.:.....||:.|..||.:|     |....      :|:.||    |::.|...: 
 Worm   547 HIPFNIPPSIEICYWNVLQIEYHYEVEITLEGGHTHNHS------IPIWIGCTEDNLSVPAQQEE 605

  Fly   326 ------LLMQEPID 333
                  |::.||.:
 Worm   606 VIPKHSLIVDEPFE 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 6/43 (14%)
Arrestin_C 179..322 CDD:214976 34/169 (20%)
arrd-28NP_509710.2 Arrestin_C 153..278 CDD:214976
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.