DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-18

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_503916.1 Gene:arrd-18 / 178763 WormBaseID:WBGene00018060 Length:450 Species:Caenorhabditis elegans


Alignment Length:397 Identity:86/397 - (21%)
Similarity:161/397 - (40%) Gaps:73/397 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQ-KKNEQPVVV 69
            ::..|.|..|:..|..::|.|.||..|....:|:.::..|.|.|:|   :.::|. |.|...:.:
 Worm     8 KVIFDQPDEVFFPGQPISGRVVLTTKENYKARAVNIKILGLAHTSW---KNYENACKFNGSSISI 69

  Fly    70 --QSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQV 132
              :|:.:...|:|..........|..:.: :.||.|.:.|...||.:.|.:|||.:|::|||::|
 Worm    70 RPRSIHYSANVNYLDYTQLLWTCEDGKNE-LAAGEYVWPFSYTLPTSIPPSFEGKYGYVRYTVKV 133

  Fly   133 LIHSSADRP----------LEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWMKPLHLQL 187
                ..|||          :.|..:..|.:.| :||:|...    |..|......|....|.:.|
 Worm   134 ----EVDRPWRKDKAKKMCITVSPLLDLNVIP-HSLTQINH----QASENISFCCFQGGILEMSL 189

  Fly   188 QIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLK----------NKPKRLETKV 242
            .||:.|:.||..:.:::.|.|....::......::|...:..:..          .:.:::..|:
 Worm   190 NIPKTGFVPGETVPLNVHLINHSSTSVNNIKAQMLQQCKFTGYKSGATYNYGGDFERNEKMSDKI 254

  Fly   243 ER-----QTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCA-CLQLNYEVEVLVTTQ 301
            :|     :.|:....:|....:.|     |..:|::...:.|.|:...: .:.:.|.::|.|   
 Worm   255 QRIKFDTKKVVKVCQKLEVPAKNE-----HKFVLELRIPSVTPTINQFSPVITVEYILQVNV--- 311

  Fly   302 QEKRLIAARMPVIIGNV-----TPPC---------PGK-LLMQEPIDGTAPEPTPPVETAS---- 347
              ..|:.....:::|:|     .||.         |.| ..:..|..|..|.||...|..:    
 Worm   312 --DGLVRCESSILLGSVPIHQYLPPAYYQQDPNLPPSKPTPIGAPPPGYGPLPTDDSEKGADAPY 374

  Fly   348 --TLIPN 352
              .|.||
 Worm   375 PLDLYPN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 37/137 (27%)
Arrestin_C 179..322 CDD:214976 26/163 (16%)
arrd-18NP_503916.1 Arrestin_N 9..158 CDD:334019 40/156 (26%)
Arrestin_C 183..327 CDD:214976 24/153 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.