DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-14

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_496881.1 Gene:arrd-14 / 175021 WormBaseID:WBGene00011055 Length:356 Species:Caenorhabditis elegans


Alignment Length:349 Identity:79/349 - (22%)
Similarity:135/349 - (38%) Gaps:73/349 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CEIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQ--KHKNQKKNEQPV 67
            |:.|:...:.||..||.|.|..:::.::.....::.:..:|...||....:  |.|..||.|:. 
 Worm     6 CDPQISFEKEVYFPGDEVKGRAWVSTTKNLKATSVEITFSGKTITAHNGKKIIKDKKCKKGEET- 69

  Fly    68 VVQSLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQV 132
                         :.::.:.|.:.........:|.|.:.|..:|||:||.:|||.:|.|||:  |
 Worm    70 -------------YVEMKHEVWTPEDTENTFPSGDYEWNFSFELPKDCPPSFEGKYGFIRYS--V 119

  Fly   133 LIHSSA--DRPLEV----------------------LHVRQLQIFPQNSLSQETRSCEIQIYEQT 173
            |:|.:.  .:|:.|                      :||..:..:........||...|      
 Worm   120 LLHIAVPNGKPINVERAVTVSSMVDLNAVNAHEPAKIHVDNVAEYCHCLPCLPTRGNVI------ 178

  Fly   174 PRLRFWMKPLHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLK---NKP 235
                       ..||.|:.||..|..:.|..::.|.....::.....|.:..||...||   |..
 Worm   179 -----------YTLQSPKCGYVAGENVIVSGQIENGTSKPMKIITAKLTRRITYREELKAKANAK 232

  Fly   236 KR------LETKVERQTVLSSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEV 294
            |:      .::|:|.| :|.::.|..|:|....::|  .....:|  |...|:.....|.:.|.|
 Worm   233 KKADGADGFKSKLEEQ-ILETKIERCNVPARSSKDF--AFSFDIP--AVVSTIRSSRLLAVEYFV 292

  Fly   295 EVLVTTQQEKRLIAARMPVIIGNV 318
            .|...|....|...|.:.:|:|||
 Worm   293 TVWGDTGTCNRGGVAALNIIVGNV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 35/139 (25%)
Arrestin_C 179..322 CDD:214976 37/149 (25%)
arrd-14NP_496881.1 Arrestin_N 6..146 CDD:334019 37/155 (24%)
Arrestin_C 173..318 CDD:214976 40/166 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28585
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.