DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-4

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_496120.1 Gene:arrd-4 / 174540 WormBaseID:WBGene00014159 Length:340 Species:Caenorhabditis elegans


Alignment Length:376 Identity:79/376 - (21%)
Similarity:134/376 - (35%) Gaps:103/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQ 70
            :|..|.....|..||||.|.|.||.......:.:.::..|.:.|                 .::.
 Worm     9 DISFDKQSEPYYPGDTVKGTVVLTNKTPLDARCVTIKCRGKSET-----------------YLIN 56

  Fly    71 SLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGTYNYGFHVKLPKNCPGNFEGGHGHIRYTLQVLIH 135
            ..|...:.|.|.|.:....|:..|.::.|.| |.:.|.:|||.:||...||..|...|.::|.| 
 Worm    57 WTDLYCKKDLFRKSEMVWVSKDGQNKMPEGG-YIWTFEIKLPIDCPPTHEGYAGGTNYKVKVEI- 119

  Fly   136 SSADRP--------LEVLHVRQLQIFPQNSLSQETRSCEIQIYEQTPRLRFWM----KPLHLQLQ 188
               |||        .|::..|:|.|  :....|:.       |..|..||..:    .|:.|::.
 Worm   120 ---DRPWKCNIREEKEIMVTRKLDI
--EKKWDQDG-------YTFTSNLRSGIFSSNGPISLKVS 172

  Fly   189 IPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVLSSRHE 253
            :|...:..|.....|.::.|....|:.|                     :..|..:|....||::
 Worm   173 VPTLVFRQGQTAEFHFEVKNHSSSTINE---------------------IFIKFGKQVHYHSRNQ 216

  Fly   254 L--------HNLPRGELQNFQHLHMLQV-PQTAATLTVAGCACLQLN---YEVEVLV---TTQQE 303
            |        |:.|            |.| .||.::..:.....|::|   |..:.::   |..:|
 Worm   217 LTPCRKFDSHSCP------------LSVYHQTNSSNCIGEATALKVNVAPYSTKSIILPFTIPEE 269

  Fly   304 KRLIAARMPVI-------IGNVTPPCPGKLLMQEPIDGTAPEPTPPVETAS 347
            .:..:....::       .|.||     ||::|..:..|......||:..:
 Worm   270 AKTPSFSTGLVNFGYFMEFGIVT-----KLIVQPRMRATIYVGEMPVDNVT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 35/134 (26%)
Arrestin_C 179..322 CDD:214976 27/168 (16%)
arrd-4NP_496120.1 Arrestin_N 8..141 CDD:334019 40/153 (26%)
Arrestin_C 163..310 CDD:367164 31/184 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.