DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and arrd-2

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_496008.1 Gene:arrd-2 / 174491 WormBaseID:WBGene00013086 Length:334 Species:Caenorhabditis elegans


Alignment Length:294 Identity:58/294 - (19%)
Similarity:103/294 - (35%) Gaps:81/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQS 71
            |...||...|..||.|:|.|.||..:....:        |....|:...|..             
 Worm     5 IVFSNPSKTYLPGDYVSGKVLLTTKDPISAR--------YMEITWKGESKCN------------- 48

  Fly    72 LDFDYRVDYFAKIDYFVGSEAAQPQ-----------------IMEAGTYNYGFHVKLPKNCPGNF 119
                           |.|||::..|                 .:.|||....|..:||:|.|.:|
 Worm    49 ---------------FGGSESSNVQRHLAGTFMGWIAKDGVDTIPAGTLKSRFRFRLPENSPPSF 98

  Fly   120 EGGHGHIRYTLQVLIHSSADRP--LEVLHVRQLQIFPQNSLS-QETRSCEIQIYEQTPRLRFWMK 181
            .|..|.|.|::.|    ..|||  |::..:...::..:.:|: .|.:..:...:.::.......|
 Worm    99 CGMFGEIEYSVTV----EFDRPWRLKLKMMNTFRVVQKTNL
TLSEPKMMKYAEFVKSKNSGTIFK 159

  Fly   182 P--LHLQLQIPRQGYSPGAGISVHLKLHNPEKLTLREAVYSLVQISTYVAHLKNKPKR------- 237
            .  ..|:|...::.:..|..|.....:.|.....:....:.|:|.|    |..::|::       
 Worm   160 DGLFLLKLHFSKRAFLAGETIRALAIMENHSTKPIINLRFELIQQS----HYHSRPQKSLCSLND 220

  Fly   238 ------LETKVER--QTVLSSRHELHNLPRGELQ 263
                  :|:|..|  :|||...:...::..||::
 Worm   221 CHSDCPIESKYRRDGETVLRGANYSCDVAPGEVK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 34/150 (23%)
Arrestin_C 179..322 CDD:214976 19/102 (19%)
arrd-2NP_496008.1 Arrestin_N 3..135 CDD:389964 37/169 (22%)
Arrestin_C 159..305 CDD:367164 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.