DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Txnip

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001008767.1 Gene:Txnip / 117514 RGDID:620886 Length:394 Species:Rattus norvegicus


Alignment Length:448 Identity:101/448 - (22%)
Similarity:169/448 - (37%) Gaps:129/448 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQ 70
            |:..::|..||.:|:.|.|.|.:.:.|...:||:.:.|.|.|...|.|..:   |.|       |
  Rat    11 EVVFNDPEKVYGSGEKVAGRVTVEVCEVTRVKAVRILACGVAKVLWMQGSQ---QCK-------Q 65

  Fly    71 SLDFDYRVDYFAKIDYFVGSEAAQPQIMEAGT-YNYGFHVKLPKNCPG-NFEGGHGHIRYTLQVL 133
            :||:....|.....|...|..  :..||..|. |.|.|..:||:...| :|:|.:|.:.|.::..
  Rat    66 TLDYLRYEDTLLLEDQPTGEN--EMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAF 128

  Fly   134 IHSSADRP----------LEVLHVRQLQ----IFPQNSLSQETRSCEIQIYEQTPRLRFWMKPLH 184
            :    |||          .||:.:..:.    :.|.::..::..||..     .|..|     :.
  Rat   129 L----DRPSQPTQEAKKNFEVMDLVDVN
TPDLMAPVSAKKEKKVSCMF-----IPDGR-----VS 179

  Fly   185 LQLQIPRQGYSPGAGISVHLKLHNP-EKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVL 248
            :..:|.|:|:..|..||:|....|. .::.:.:|  ::|...||:|:       .:|||..|. |
  Rat   180 VSARIDRKGFCEGDDISIHADFENTCSRIVVPKA--AIVARHTYLAN-------GQTKVLTQK-L 234

  Fly   249 SSRHELHNLP------RGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLI 307
            ||....|.:.      ||:....|.:..          ::.||..|::.|.:.:.|:....|::|
  Rat   235 SSVRGNHIISGTCASWRGKSLRVQKIRP----------SILGCNILRVEYSLLIYVSVPGSKKVI 289

  Fly   308 AARMPVIIG-------------------------NV-----TPPCPGKLLMQEPIDGTAPEPTPP 342
             ..:|::||                         |:     .|||...::   |.|.....||.|
  Rat   290 -LDLPLVIGSRSGLSSRTSSMASRTSSEMSWIDLNIPDTPEAPPCYMDVI---PEDHRLESPTTP 350

  Fly   343 VETASTLIPNFSISTTSLASNFREAEFMVATNLNKTNKHYLSGEQLDFRPRYVYYEMD 400
                  |:.:...|..|       ..||.|             .:..|.|...|.|:|
  Rat   351 ------LLDDVDDSQDS-------PIFMYA-------------PEFQFMPPPTYTEVD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 38/136 (28%)
Arrestin_C 179..322 CDD:214976 36/179 (20%)
TxnipNP_001008767.1 Arrestin_N 10..152 CDD:304627 42/156 (27%)
Arrestin_C 174..298 CDD:280848 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.