DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and TXNIP

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_016855574.1 Gene:TXNIP / 10628 HGNCID:16952 Length:395 Species:Homo sapiens


Alignment Length:405 Identity:88/405 - (21%)
Similarity:151/405 - (37%) Gaps:131/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIQLDNPRGVYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQ 70
            |:..::|..||.:|:.|.|.|.:.:.|...:||:.:.|.|.|...|.|..:...|..        
Human    11 EVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTS-------- 67

  Fly    71 SLDFDYRVDYFAKIDYFVGSEAAQPQ------IMEAGT-YNYGFHVKLPKNCPG-NFEGGHGHIR 127
                    :|....|..:..:  ||.      ||..|. |.|.|..:||:...| :|:|.:|.:.
Human    68 --------EYLRYEDTLLLED--QPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVD 122

  Fly   128 YTLQVLIHSSADRPLEVLHVRQLQIFPQNSLSQETRSCEIQIYE----QTPRLRFWMKP------ 182
            |.::..:    |||              :..:|||:. ..::.:    .||.|   |.|      
Human   123 YWVKAFL----DRP--------------SQPTQETKK-NFEVVDLVDVNTPDL---MAPVSAKKE 165

  Fly   183 ------------LHLQLQIPRQGYSPGAGISVHLKLHNP-EKLTLREAVYSLVQISTYVAHLKNK 234
                        :.:..:|.|:|:..|..||:|....|. .::.:.:|  ::|...||:|:    
Human   166 KKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVVPKA--AIVARHTYLAN---- 224

  Fly   235 PKRLETKVERQTVLSSRHELHNLP------RGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYE 293
               .:|||..|. |||....|.:.      ||:....|.:..          ::.||..|::.|.
Human   225 ---GQTKVLTQK-LSSVRGNHIISGTCASWRGKSLRVQKIRP----------SILGCNILRVEYS 275

  Fly   294 VEVLVTTQQEKRLIAARMPVIIG-------------------------NV-----TPPCPGKLLM 328
            :.:.|:....|::| ..:|::||                         |:     .|||...:: 
Human   276 LLIYVSVPGSKKVI-LDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVI- 338

  Fly   329 QEPIDGTAPEPTPPV 343
              |.|.....||.|:
Human   339 --PEDHRLESPTTPL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 35/142 (25%)
Arrestin_C 179..322 CDD:214976 38/197 (19%)
TXNIPXP_016855574.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.