DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18744 and Arrdc3

DIOPT Version :9

Sequence 1:NP_652647.2 Gene:CG18744 / 59140 FlyBaseID:FBgn0042101 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001036056.1 Gene:Arrdc3 / 105171 MGIID:2145242 Length:414 Species:Mus musculus


Alignment Length:446 Identity:100/446 - (22%)
Similarity:174/446 - (39%) Gaps:116/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VYRAGDTVNGHVYLTLSERALIKAICLEANGYASTAWQQPQKHKNQKKNEQPVVVQSLDFDYRVD 79
            ||.:||||:|.|.|.::....:|::.:.|.|:|...|       .:.:|.......:.::...|:
Mouse    23 VYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRW-------TESRNAGSNTAYTQNYTEEVE 80

  Fly    80 YFAKIDYFVGSEAAQPQIME------AGTYNYGFHVKLPKN-CPGNFEGGHGHIRYTLQVLIHSS 137
            ||...|..:|.|.......|      :|.:.|.|..:||:. ...:|||.||.:||.::..:|  
Mouse    81 YFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQTPLATSFEGRHGSVRYWVKAELH-- 143

  Fly   138 ADRP--LEVLHVRQLQIF------------PQNSLSQETRSCEIQIYEQTPRLRFWM---KPLHL 185
              ||  |.|...::..:|            ||....::|..|             |.   .|:.|
Mouse   144 --RPWLLPVKLKKEFTVFEHIDIN
TPSLLSPQAGTKEKTLCC-------------WFCTSGPISL 193

  Fly   186 QLQIPRQGYSPGAGISVHLKLHN--PEKLTLREAVYSLVQISTYVAHLKNKPKRLETKVERQTVL 248
            ..:|.|:||:||..|.:..::.|  ...:..:.|:|     .|...:.|.|.|.:     :|.|.
Mouse   194 SAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIY-----QTQAFYAKGKMKEV-----KQLVA 248

  Fly   249 SSRHELHNLPRGELQNFQHLHMLQVPQTAATLTVAGCACLQLNYEVEVLVTTQQEKRLIAARMPV 313
            :.|.|  :|..|:.:.:.. .:|::|..:.  ::..|:.:::.|.:.|.|.......|:.: :|:
Mouse   249 NLRGE--SLSSGKTETWNG-KLLKIPPVSP--SILDCSIIRVEYSLMVYVDIPGAMDLLLS-LPL 307

  Fly   314 IIGNVTPPCPGKLLMQEPIDGTAPEPTPPV-ETASTLIPNFSISTTSLASNFRE--------AEF 369
            :||.:                    |..|. ...|::....|:|...||....|        || 
Mouse   308 VIGTI--------------------PLHPFGSRTSSVSSQCSMSMNWLALALPERPEAPPSYAE- 351

  Fly   370 MVATNLNKTN-----------KHYLSG------EQLDFRPRYVYYEMDQT--QSEE 406
             |.|...:.|           :..|.|      ::..|.|..:|.|:|..  ||.|
Mouse   352 -VVTEEQRRNNLAPVGACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSSE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18744NP_652647.2 Arrestin_N 5..141 CDD:304627 35/132 (27%)
Arrestin_C 179..322 CDD:214976 33/147 (22%)
Arrdc3NP_001036056.1 Arrestin_N 22..165 CDD:278754 40/152 (26%)
Arrestin_C 187..314 CDD:214976 32/162 (20%)
PPxY motif 1. /evidence=ECO:0000305 346..349 0/2 (0%)
PPxY motif 2. /evidence=ECO:0000305 391..394 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.