DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TMPRSS11D

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_004253.1 Gene:TMPRSS11D / 9407 HGNCID:24059 Length:418 Species:Homo sapiens


Alignment Length:312 Identity:109/312 - (34%)
Similarity:152/312 - (48%) Gaps:40/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCG-NINT--RH 81
            |:...|..|...::|||...|..:...: |.| |..:..|.|.      ..||..| ::.|  ..
Human   129 ASMKSRIESVLRQMLNNSGNLEINPSTE-ITS-LTDQAAANWL------INECGAGPDLITLSEQ 185

  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC------------VNGFYHRLIT 134
            ||:||.|.|...:||.:.|......:||.||:|:.:.||||||            .:|.......
Human   186 RILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNSNPRDWIATSGISTTFPK 250

  Fly   135 VRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY 199
            :|:               ||..:|||..|.:...::||||:|....|....|:|.||:|..::|.
Human   251 LRM---------------RVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVCLPAATQNI 300

  Fly   200 -AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSC 263
             .|.||.||||||....|.....|::.:|.|:|.:.|...:.....|...|:||| |.|||.|:|
Human   301 PPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVCNAPHSYNGAILSGMLCAG-VPQGGVDAC 364

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |||||||:....|...:.:.||||||:.|..|:.|||||||.::.|||.:.|
Human   365 QGDSGGPLVQEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWIRQQT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/241 (37%)
Tryp_SPc 83..314 CDD:238113 91/243 (37%)
TMPRSS11DNP_004253.1 SEA 48..143 CDD:279699 3/13 (23%)
Tryp_SPc 186..412 CDD:214473 90/241 (37%)
Tryp_SPc 187..415 CDD:238113 91/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.