DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TMPRSS13

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001070731.1 Gene:TMPRSS13 / 84000 HGNCID:29808 Length:567 Species:Homo sapiens


Alignment Length:285 Identity:94/285 - (32%)
Similarity:154/285 - (54%) Gaps:22/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECS-CGNINTRHRIVGGQETEVHEYPWMI 98
            |:.:.||.:|.:.  :|:...|.|::     :....:|| ||......|||||......::||.:
Human   284 NSFSILRYNSTIQ--ESLHRSECPSQ-----RYISLQCSHCGLRAMTGRIVGGALASDSKWPWQV 341

  Fly    99 MLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE-----HNRQDSHVKIVDRRVSRVL 158
            .|.:.....||.:|::.|:.||||||   |:  :...::||     ....:.|.......::.::
Human   342 SLHFGTTHICGGTLIDAQWVLTAAHC---FF--VTREKVLEGWKVYAGTSNLHQLPEAASIAEII 401

  Fly   159 IHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA-GQTAVVTGWGALSE-GGPISDT 221
            |:..|:....|.||||:|.::|:.|...:||.|:|...:.:: .:|..:||:|...| ....|..
Human   402 INSNYTDEEDDYDIALMRLSKPLTLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPF 466

  Fly   222 LQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIV 286
            |:||:|.::..::|.:....:|.:|..|:|||.: :||:||||||||||: |....:.:.|||:.
Human   467 LREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDL-RGGRDSCQGDSGGPL-VCEQNNRWYLAGVT 529

  Fly   287 SWGEGCAKPNAPGVYTRVGSFNDWI 311
            |||.||.:.|.|||||:|.....||
Human   530 SWGTGCGQRNKPGVYTKVTEVLPWI 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/235 (34%)
Tryp_SPc 83..314 CDD:238113 82/236 (35%)
TMPRSS13NP_001070731.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
13 X 5 AA repeats of A-S-P-A-[GLQR] 9..93
4 X 5 AA repeats of T-P-P-G-R 14..68
DUF3682 16..>87 CDD:289231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..157
SRCR_2 231..320 CDD:292133 11/42 (26%)
Tryp_SPc 325..554 CDD:214473 81/235 (34%)
Tryp_SPc 326..557 CDD:238113 82/236 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.