DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and PRSS27

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:262 Identity:98/262 - (37%)
Similarity:148/262 - (56%) Gaps:21/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV---- 125
            ::|..|..:||.....:|:||||:|:..|:||.:.:...|:.:||.||:.:|:.||||||.    
Human    17 SQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTS 81

  Fly   126 -NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHP 189
             ...|..|:..|.|.  :...|....  ||.:|..:|.|......:|:||:....||.....:.|
Human    82 ETSLYQVLLGARQLV--QPGPHAMYA--RVRQVESNPLYQGTASSADVALVELEAPVPFTNYILP 142

  Fly   190 VCMPTPSENY-AGQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEEC-----RNSNYG--ESK 244
            ||:|.||..: .|....|||||:.||..  |....||::.|||:...:|     :::.:|  ...
Human   143 VCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKT 207

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            |.::|:|||: |:|.||:|:||||||:..| .|.::..||::|||||||:.|.||||.||.:.::
Human   208 IKNDMLCAGF-EEGKKDACKGDSGGPLVCL-VGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHN 270

  Fly   310 WI 311
            ||
Human   271 WI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/243 (38%)
Tryp_SPc 83..314 CDD:238113 93/244 (38%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 92/243 (38%)
Tryp_SPc 36..275 CDD:238113 93/243 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.