DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss5

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:298 Identity:106/298 - (35%)
Similarity:157/298 - (52%) Gaps:24/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NLAQLRQSSFLDWIQSILGPE--VPAEW----SSPAKR----ECAECSCGNINTRHRIVGGQETE 90
            ||:.::.:...::.|....|.  |...|    :.|:.|    :|:||....:.:  ||||||...
Mouse   163 NLSDIKLNRSQEFAQLSARPGGLVEESWKPSANCPSGRIVSLKCSECGARPLAS--RIVGGQAVA 225

  Fly    91 VHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGF-YHRLITVR----LLEHNRQDSHVKIV 150
            ...:||...:|......||||::...:.:|||||:..| ..||.:.|    |:.|.....|...:
Mouse   226 SGRWPWQASVMLGSRHTCGASVLAPHWVVTAAHCMYSFRLSRLSSWRVHAGLVSHGAVRQHQGTM 290

  Fly   151 DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA-GQTAVVTGWGALSE 214
               |.:::.||.||.:|.|.|:||::...|:.....:..||:|...:::. |....|:|||....
Mouse   291 ---VEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVGAVCLPAKEQHFPWGSQCWVSGWGHTDP 352

  Fly   215 GGP-ISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGD 278
            ... .|||||:..||:||...|.:|......:|..|:||||:: |..|:||||||||: |..|||
Mouse   353 SHTHSSDTLQDTMVPLLSTYLCNSSCMYSGALTHRMLCAGYLD-GRADACQGDSGGPL-VCPSGD 415

  Fly   279 AYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            .:.|.|:||||.|||:||.||||.:|..|.|||.:..:
Mouse   416 TWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWIHDTVQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 93/235 (40%)
Tryp_SPc 83..314 CDD:238113 94/237 (40%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 11/49 (22%)
Tryp_SPc 217..448 CDD:214473 93/235 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.